You Searched For: \\u03B1-Bromo-3,4-dichlorotoluene

Catalog Number: (CA11029-080)

Supplier: Rockland Immunochemical

Description: Anti-Deoxyribonuclease I (Bovine Pancreas) (Rabbit) Antibody Biotin Conjugated - Anti-Deoxyribonuclease I Has Been Assayed Against 1Ug Of Deoxyribonuclease I In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.

Catalog Number: (CA11029-258)

Supplier: Rockland Immunochemical

Description: Anti-Glucose-6-Phosphate Dehydrogenase (Goat) Antibody Biotin Conjugated Has Been Assayed Against 1Ug Of Glucose-6-Phosphate Dehydrogenase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.

Catalog Number: (103294-252)

Supplier: Novus Biologicals

Description: The SUSD2 Antibody (1279B) [Biotin] from Novus Biologicals is a rabbit monoclonal antibody to SUSD2. This antibody reacts with human, rat. The SUSD2 Antibody (1279B) [Biotin] has been validated for the following applications: Western Blot, Flow Cytometry.

Catalog Number: (CA11029-208)

Supplier: Rockland Immunochemical

Description: Anti-Carboxypeptidase Y (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1 Ug Of Carboxypeptidase Y In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.

Catalog Number: (103008-518)

Supplier: Anaspec Inc

Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (CA11029-310)

Supplier: Rockland Immunochemical

Description: Anti-Lipoamide Dehydrogenase (Porcine Heart) (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1Ug Of Lipoamide Dehydrogenase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.

Catalog Number: (103360-158)

Supplier: Novus Biologicals

Description: The PMS2 Antibody (163C1251) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to PMS2. This antibody reacts with human, mouse. The PMS2 Antibody (163C1251) [Biotin] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Catalog Number: (89495-116)

Supplier: Genscript

Description: THE™ V5 Tag antibody [Biotin], mAb, Mouse recognizes N-terminal and C-terminal V5 tagged fusion proteins.

Catalog Number: (103359-958)

Supplier: Novus Biologicals

Description: The DAP3 Antibody (42C617.1.2) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to DAP3. This antibody reacts with human, mouse. The DAP3 Antibody (42C617.1.2) [Biotin] has been validated for the following applications: Western Blot.

Catalog Number: (103359-930)

Supplier: Novus Biologicals

Description: The MBD1 Antibody (100B272.1) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to MBD1. This antibody reacts with human, mouse. The MBD1 Antibody (100B272.1) [Biotin] has been validated for the following applications: Western Blot.

Catalog Number: (CA11029-326)

Supplier: Rockland Immunochemical

Description: Anti-Penicillinase (Enterobacter Cloacae) (Rabbit) Antibody Biotin Conjugated - Anti-Penicillinase Antibody Has Been Assayed Against 1Ug Of Penicillinase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.

Catalog Number: (CA11029-206)

Supplier: Rockland Immunochemical

Description: Anti-Ferritin (Rabbit) Antibody Biotin Conjugated - Anti-Ferritin Antibody Is Suitable For ELISA, Western Blot And Immunohistochemistry. Expect Band At 21.2 Kda In Appropriate Cell Lysate Or Extract.

Catalog Number: (102996-412)

Supplier: Anaspec Inc

Description: This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (ABCA_AB53494-1MG)

Supplier: Abcam

Description: Rabbit polyclonal to Biotin.

New Product

Catalog Number: (CA11029-302)

Supplier: Rockland Immunochemical

Description: Anti-Carboxypeptidase A (Rabbit) Antibody Biotin Conjugated - Anti-Carboxypeptidase A Has Been Assayed Against 1Ug Of Carboxypeptidase A In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.

Catalog Number: (CA405601-BL)

Supplier: Biolegend

Description: Biotin Goat anti-hamster (Syrian) IgG [Poly4056]; Isotype: Goat Polyclonal IgG; Reactivity: Hamster; Apps: FC, ELISA, IHC, IF, WB; Size: 500 μg