Print…

You Searched For: Sodium+glutamate


13,002  results were found

Refine Results Sort by
SearchResultCount:"13002"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10349-410

Anti-GGT1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10349-410)
Supplier: Bioss
Description: Cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates, and other gamma-glutamyl compounds. The metabolism of glutathione releases free glutamate and the dipeptide, cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Initiates extracellular glutathione (GSH) breakdown, provides cells with a local cysteine supply and contributes to maintain intracellular GSH level. It is part of the cell antioxidant defense mechanism. Isoform 3 seems to be inactive.
Image Unavailable-10426-798

Anti-CENTG1 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10426-798)
Supplier: Bioss
Description: GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.
Product Image-CAJT3262-7

L(+)-Potassium sodium tartrate tetrahydrate 99.0-102.0%, crystals, BAKER ANALYZED® ACS, J.T.Baker®

Supplier: VWR International
Description: L(+)-Potassium sodium tartrate tetrahydrate ≥99%, crystals, BAKER ANALYZED® ACS

Certificates

Product Image-10750-028

Anti-GRIK4 Rabbit Polyclonal Antibody

Catalog Number: (10750-028)
Supplier: Prosci
Description: Grik4 Antibody: Grik4 codes for the KA1 subunit of kainate-type ionotropic glutamate receptors which are critical regulators of network activity that act by modifying neuronal excitability, directly and indirectly, through GABAergic interneurons. Five subunits can assemble to form kainate receptors (KARs): GluR5 (coded by Grik1), GluR6 (coded by Grik2), and GluR7 (coded by Grik3) are the low-affinity subunits, and KA1 and KA2 are the high-affinity subunits. In the adult brain, KARs are located pre- and postsynaptically on pyramidal cells and on interneurons. Kainate receptors on GABA-containing interneurons enhance GABA release and thereby downregulate glutamatergic signaling. KARs have been implicated in numerous psychiatric disorders. Case control studies show significant association of Grik4 with both schizophrenia and bipolar disorder.
Product Image-10349-408

Anti-GGT1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10349-408)
Supplier: Bioss
Description: Cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates, and other gamma-glutamyl compounds. The metabolism of glutathione releases free glutamate and the dipeptide, cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Initiates extracellular glutathione (GSH) breakdown, provides cells with a local cysteine supply and contributes to maintain intracellular GSH level. It is part of the cell antioxidant defense mechanism. Isoform 3 seems to be inactive.
Image Unavailable-76083-154

Anti-GGT1 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76083-154)
Supplier: Bioss
Description: Cleaves the gamma-glutamyl bond of extracellular glutathione (gamma-Glu-Cys-Gly), glutathione conjugates, and other gamma-glutamyl compounds. The metabolism of glutathione releases free glutamate and the dipeptide, cysteinyl-glycine, which is hydrolyzed to cysteine and glycine by dipeptidases. In the presence of high concentrations of dipeptides and some amino acids, can also catalyze a transpeptidation reaction, transferring the gamma-glutamyl moiety to an acceptor amino acid to form a new gamma-glutamyl compound. Initiates extracellular glutathione (GSH) breakdown, provides cells with a local cysteine supply and contributes to maintain intracellular GSH level. It is part of the cell antioxidant defense mechanism. Isoform 3 seems to be inactive.
Image Unavailable-10426-780

Anti-CENTG1 Rabbit Polyclonal Antibody

Catalog Number: (10426-780)
Supplier: Bioss
Description: GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.
Image Unavailable-76081-374

Anti-Centaurin gamma 1 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76081-374)
Supplier: Bioss
Description: GTPase-activating protein (GAP) for ARF1 and ARF5, which also shows strong GTPase activity. Isoform 1 participates in the prevention of neuronal apoptosis by enhancing PI3 kinase activity. It aids the coupling of metabotropic glutamate receptor 1 (GRM1) to cytoplasmic PI3 kinase by interacting with Homer scaffolding proteins, and also seems to mediate anti-apoptotic effects of NGF by activating nuclear PI3 kinase. Isoform 2 does not stimulate PI3 kinase but may protect cells from apoptosis by stimulating Akt. It also regulates the adapter protein 1 (AP-1)-dependent trafficking of proteins in the endosomal system. It seems to be oncogenic. It is overexpressed in cancer cells, prevents apoptosis and promotes cancer cell invasion.
Image Unavailable-103007-212

Human [Gln22, Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-212)
Supplier: Anaspec Inc
Description: This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-89415-688

Anti-PIKE Rabbit Polyclonal Antibody

Catalog Number: (89415-688)
Supplier: Prosci
Description: PIKE Antibody: Phosphoinositide 3 kinase enhancer (PIKE) is a recently identified nuclear GTPase that interacts with nuclear phosphoinositide 3-kinase (PI3 kinase) to stimulate its lipid kinase activity. PIKE exists in multiple isoforms; a shorter C-terminal isoform (PIKE-A) has also been identified as centaurin gamma 1. The longest isoform (PIKE-L) has been shown to bind to the adaptor protein Homer and thereby link to metabotropic glutamate receptors, leading to activation of PI3 kinase activity and prevention of neuronal apoptosis. Overexpression of PIKE-A enhances Akt activity and promotes cancer cell invasion, whereas decreased expression of PIKE-A via dominant negative expression of PIKE-A or PIKE-A knockdown inhibits these processes. In many human cancers, expression of PIKE-A is enhanced, leading to increased Akt activity and preventing apoptosis.
Image Unavailable-10427-272

Anti-POMT1 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10427-272)
Supplier: Bioss
Description: POMT1 (Protein O mannosyl transferase 1) is a multipass membrane protein that is found in the endoplasmic reticulum. POMT1 catalyses the transfer of mannosyl residues to the hydroxyl groups of serine or threonine residues. Enzymatic activity is dependent on co expression of POMT1 with POMT2. Defects in the POMT1 gene are associated with Walker-Warburg syndrome (WWS), a congential muscular dystrophy that is associated with mental retardation and is usually lethal within the first few months of life. Other defects in the POMT1 gene result in limb girdle muscular dystrophy type 2K (LGMD2K), which is associated with mild mental retardation. Studies in Drosophila suggest that mutation of POMT1 alters the efficacy of synaptic transmission and a change in subunit composition of post synaptic glutamate receptors at the neuromuscular junction. Missense mutations in POMT1 have been associated with glioneuronal and glial brain tumours.
Image Unavailable-10427-274

Anti-POMT1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10427-274)
Supplier: Bioss
Description: POMT1 (Protein O mannosyl transferase 1) is a multipass membrane protein that is found in the endoplasmic reticulum. POMT1 catalyses the transfer of mannosyl residues to the hydroxyl groups of serine or threonine residues. Enzymatic activity is dependent on co expression of POMT1 with POMT2. Defects in the POMT1 gene are associated with Walker-Warburg syndrome (WWS), a congential muscular dystrophy that is associated with mental retardation and is usually lethal within the first few months of life. Other defects in the POMT1 gene result in limb girdle muscular dystrophy type 2K (LGMD2K), which is associated with mild mental retardation. Studies in Drosophila suggest that mutation of POMT1 alters the efficacy of synaptic transmission and a change in subunit composition of post synaptic glutamate receptors at the neuromuscular junction. Missense mutations in POMT1 have been associated with glioneuronal and glial brain tumours.
Image Unavailable-89360-084

Anti-PICK1 Rabbit Polyclonal Antibody

Catalog Number: (89360-084)
Supplier: Genetex
Description: PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins play a central role in synaptic membrane protein localization. The protein interacting with protein kinase C (PICK 1) is a synaptic PDZ domain protein that also contains a coiled-coil and acidic domain. Studies indicate that PICK 1 functions as a targeting and transport protein and has been shown to interact with protein kinase C alpha (PKC alpha), AMPA-type glutamate receptors, and several other membrane receptors via its PDZ domain. The interaction of PICK 1 with PKC alpha is highly dependent on the activation of the kinase. It appears that PICK 1 directs the activated form of PKC alpha to membrane anchored GluR2. Once phosphorylated by PKC alpha, GluR2 is released from the synaptic anchor proteins. Once released, GluR2 is transported from the synaptic membrane in a PICK 1-dependent manner.
Product Image-BDH9286-500G

Sodium chloride ≥99.0% ACS analytical reagent, VWR Chemicals BDH®

Supplier: VWR International
Description: Meets reagent specifications for testing USP/NF monographs.

SDS Certificates

Product Image-BDH9288-2.5KG

tri-Sodium citrate dihydrate ≥99.0% ACS, VWR Chemicals BDH®

Catalog Number: (BDH9288-2.5KG)
Supplier: VWR International
Description: Colorless or white solid

SDS Certificates


Image Unavailable-10427-276

Anti-POMT1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10427-276)
Supplier: Bioss
Description: POMT1 (Protein O mannosyl transferase 1) is a multipass membrane protein that is found in the endoplasmic reticulum. POMT1 catalyses the transfer of mannosyl residues to the hydroxyl groups of serine or threonine residues. Enzymatic activity is dependent on co expression of POMT1 with POMT2. Defects in the POMT1 gene are associated with Walker-Warburg syndrome (WWS), a congential muscular dystrophy that is associated with mental retardation and is usually lethal within the first few months of life. Other defects in the POMT1 gene result in limb girdle muscular dystrophy type 2K (LGMD2K), which is associated with mild mental retardation. Studies in Drosophila suggest that mutation of POMT1 alters the efficacy of synaptic transmission and a change in subunit composition of post synaptic glutamate receptors at the neuromuscular junction. Missense mutations in POMT1 have been associated with glioneuronal and glial brain tumours.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
993 - 1,008 of 13,002
no targeter for Bottom