You Searched For: Sodium+glutamate


13,003  results were found

SearchResultCount:"13003"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (BDH7620-1)
Supplier: VWR International
Description: NIST traceable. Suitable as a titrant.

Catalog Number: (BDH7224-1)
Supplier: VWR International
Description: AOAC and APHA. Suitable as a titrant.

Catalog Number: (89283-834)
Supplier: Genetex
Description: Rabbit polyclonal antibody to NMDA NR2B Subunit (phospho Tyr1252)


Catalog Number: (89284-040)
Supplier: Genetex
Description: Rabbit polyclonal antibody to NMDA, NR2C Subunit (phospho Ser1096)


Supplier: VWR International
Description: Clear liquid. Corrosive and toxic.
Supplier: VWR International
Description: Made with deionized water. Suitable as a titrant.
Catalog Number: (BDH7472-1)
Supplier: VWR International
Description: Made with deionized water. Suitable as a titrant.

Catalog Number: (89284-042)
Supplier: Genetex
Description: Rabbit polyclonal antibody to NMDA, NR2C Subunit


Supplier: VWR International
Description: Made with deionized water. Suitable as a titrant.
Catalog Number: (10751-830)
Supplier: Prosci
Description: GRINA Antibody: The transmembrane BAX inhibitor motif (TMBIM) family of proteins includes the founder member TMBIM6/BI-1, TMBIM1/RECS1 (responsive to centrifugal force and shear stress gene 1 protein), TMBIM2/LFG (life guard), TMBIM3/GRINA (glutamate receptor ionotropic NMDA protein 1), TMBIM4/GAAP (Golgi anti-apoptotic-associated protein), and TMBIM5/GHTIM (growth hormone-inducible transmembrane protein). They are highly conserved in mammals and zebrafish and contain a conserved BAX inhibitor-1 motif. GRINA is expressed in the brain and is a potential apoptotic regulator.


Supplier: VWR International
Description: Suitable as a titrant. Made with deionized water.
Catalog Number: (10087-302)
Supplier: Proteintech
Description: GAD2, also named as GAD65, belongs to the group II decarboxylase family. GAD2 catalyzes the production of GABA. It is responsible for the synthesis of the essential neurotransmitter gamma-aminobutyric acid (GABA) from L-glutamic acid. GAD2 is expressed in nervous and endocrine systems and are thought to be involved in synaptic transmission and insulin secretion. Autoantibodies against GAD2 may serve as markers for type I diabetes. Many individuals suffering from an adult onset disorder known as Stiff Person Syndrome (SPS) also express autoantibodies to GAD2. The antibody is specific to GAD2.


Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (76082-216)
Supplier: Bioss
Description: The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits. Alternatively spliced transcript variants have been described.


Catalog Number: (89284-052)
Supplier: Genetex
Description: Rabbit polyclonal antibody to NMDA NR2A Subunit


Catalog Number: (BDH7466-1)
Supplier: VWR International
Description: Made with purified water and ACS grade sodium chloride.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
865 - 880 of 13,003
no targeter for Bottom