Print…

You Searched For: Sodium+glutamate


17,901  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"17901"

Rate These Search Results

Product Image-10111-178

GRIA2 Antibody

Description: Polyclonal, Host: Rabbit, Species Reactivity: human, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human GRIA2, purified by protein A chromatography method, Application: ELISA, western blot.
Catalog Number: 10111-178
Supplier: Prosci
Image Unavailable-76101-710

NQO1 Polyclonal Antibody 100UL

Description: NQO1 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Conjugate: AF680, Source: KLH conjugated synthetic peptide derived from human, Synonym: DTD, QR1, DHQU, DIA4, NMOR1, NMORI, NAD(P)H dehydrogenase, Apps: IF(IHC-P), Size: 100UL
Catalog Number: 76101-710
Supplier: Bioss
Product Image-89417-782

Antibody GLS2 0.1MG

Description: polyclonal antibody Glutaminase 2 Host: rabbit species reactivity: human mouse rat Isotype: IgG Immunogen: GLS2 Antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2 Application: Western blot
Catalog Number: 89417-782
Supplier: Prosci
Image Unavailable-103007-216

[Lys22] - beta - Amyloid (1 - 42) 0.5 mg

Description: [Lys22] - beta - Amyloid (1 - 42), Italian Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, lysine substituted for glutamic acid at position 22, Molecular Weight: 4513.2, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-216
Supplier: Anaspec Inc
Image Unavailable-10494-500

VGLUT2 Antibody

Description: VGLUT2 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,FITC Conjugated, Isotype: IgG, Emmission/Excitation: 494nm/518nm, Application: IF(IHC-P), Synonymns: VGLUT 2; VGluT2, 100ul
Catalog Number: 10494-500
Supplier: Bioss
Image Unavailable-10663-958

GPR70 Antibody

Description: GPR70 Antibody, Polyclonal, Cy3 Conjugated, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, Synonyms: TR1; T1R1; GM148; GPR70; Taste receptor type 1 member 1, Application: WB, IHC-P, IF(IHC-P)
Catalog Number: 10663-958
Supplier: Bioss
Image Unavailable-10663-968

GPR70 Antibody

Description: GPR70 Antibody, Polyclonal, HRP Conjugated, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, Synonyms: TR1; T1R1; GM148; GPR70; Taste receptor type 1 member 1, Application: WB, IHC-P, IF(IHC-P)
Catalog Number: 10663-968
Supplier: Bioss
Image Unavailable-10447-374

CHRNA3 Antibody

Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-374
Supplier: Bioss
Image Unavailable-76108-870

GPR70 Polyclonal Antibody 100ul

Description: GPR70 Antibody, Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, Conjugate: Alexa Fluor 680, Concentration: 1ug/ul, Synonyms: TR1; T1R1; GM148; GPR70; Taste receptor type 1 member 1, Application: WB, IHC-P, IF(IHC-P), Size: 100ul
Catalog Number: 76108-870
Supplier: Bioss
Product Image-10109-148

GLS2 Antibody

Description: Polyclonal, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human GLS2. purified by protein A chromatography method. Application: E, WB
Catalog Number: 10109-148
Supplier: Prosci
Image Unavailable-76111-066

VGLUT2 Polyclonal Antibody 100ul

Description: VGLUT2 Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Application: WB, IHC-P, IF, Conjugate: Alexa Fluor 680, Source: KLH conjugated synthetic peptide derived from human VGLUT2 Synonyms: VGLUT 2, VGluT2, Size: 100ul
Catalog Number: 76111-066
Supplier: Bioss
Product Image-10325-648

NQO1 Antibody

Description: NQO1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DTD; QR1; DHQU; DIA4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10325-648
Supplier: Bioss
Image Unavailable-10325-662

NQO1 Antibody

Description: NQO1 Polyclonal Antibody, Host: Rabbit, Cy5 Conjugated, Emmission: 625, 650nm/670nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: DTD; QR1; DHQU; DIA4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10325-662
Supplier: Bioss
Product Image-10109-192

SLC38A1 Antibody

Description: Polyclonal, Host: Rabbit, Species: Human, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human SLC38A1. purified by protein A chromatography method. Application: E, WB, IHC
Catalog Number: 10109-192
Supplier: Prosci
Image Unavailable-10473-994

ATE1 Antibody

Description: ATE1 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Arginine tRNA protein transferase 1; Arginyl-tRNA--protein transferase 1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10473-994
Supplier: Bioss
Image Unavailable-10663-946

GPR70 Antibody

Description: GPR70 Antibody, Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, isotype: IgG, Synonyms: TR1; T1R1; GM148; GPR70; Taste receptor type 1 member 1, Application: WB, IHC-P, IF(IHC-P)
Catalog Number: 10663-946
Supplier: Bioss
817 - 832 of 17,901