Print…

You Searched For: Sodium+glutamate


13,001  results were found

Refine Results Sort by
SearchResultCount:"13001"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-76082-224

Anti-NMDAR2A Tyr1325 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76082-224)
Supplier: Bioss
Description: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate-gated ion channels. These receptors have been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C) and NMDAR2D (GRIN2D). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Image-10751-254

Anti-GLS2 Rabbit Polyclonal Antibody

Catalog Number: (10751-254)
Supplier: Prosci
Description: GLS2 Antibody: Phosphate-activated glutaminase, also known as Glutaminase 2 (GLS2), was initially isolated from rat liver, although it has been shown to be expressed in other tissues. Like the functionally similar, larger kidney glutaminase, GLS2 catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Expression of GLS2 is increased by p53 under both stressed and nonstressed conditions, resulting in increased levels of glutamate and alpha-ketoglutarate, which in turn results in enhanced mitochondrial respiration and ATP generation. GLS2 also regulates antioxidant defense function in cells by increasing reduced glutathione levels and decreasing ROS-levels, suggesting that GLS2 acts as a mediator of p53's role in antioxidant defense in addition to its role in energy metabolism.
Image Unavailable-10494-494

Anti-VGLUT2 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10494-494)
Supplier: Bioss
Description: Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.
Image Unavailable-I-1180.0250BA

Glu-NH-med

Catalog Number: (I-1180.0250BA)
Supplier: Bachem Americas
Description: Sequence: H-Glu-AMC
Image Unavailable-10447-378

Anti-CHRNA3 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10447-378)
Supplier: Bioss
Description: Members of the ligand-gated ion channel receptor family are characterized by their fast transmitting response to neurotransmitters. Two important members of this family are the nicotinic acetylcholine and glutamate receptors, both of which are composed of five homologous subunits forming a transmembrane aqueous pore. These transmembrane receptors change conformation in response to their cognate neurotransmitter. Nicotinic acetylcholine receptors (AChRs) are found at the postsynaptic membrane of the neuromuscular junction and bind acetylcholine molecules, allowing ions to move through the pore. Glutamate receptors are found in the postsynaptic membrane of cells in the central nervous system. The activity that is generated at the synapse by the binding of acetylcholine is terminated by acetylcholinesterase, an enzyme that rapidly hydrolyzes acetylcholine. AChR?, also known as LNCR2, PAOD2, NACHRA3 or CHRNA3, is a 505 amino acid multi-pass membrane protein that belongs to the ligand-gated ion channel receptor family and may play a role in neurotransmission.
Product Image-10109-458

Anti-ALDH4A1 Rabbit Polyclonal Antibody

Catalog Number: (10109-458)
Supplier: Prosci
Description: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.This protein belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. Two transcript variants encoding the same protein have been identified for this gene.
Product Image-10102-080

Anti-RERE Rabbit Polyclonal Antibody

Catalog Number: (10102-080)
Supplier: Prosci
Description: RERE is a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. RERE co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development.This gene encodes a member of the atrophin family of arginine-glutamic acid (RE) dipeptide repeat-containing proteins. The encoded protein co-localizes with a transcription factor in the nucleus, and its overexpression triggers apoptosis. A similar protein in mouse associates with histone deacetylase and is thought to function as a transcriptional co-repressor during embryonic development. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Image-10209-754

Anti-GCLC Rabbit Polyclonal Antibody

Catalog Number: (10209-754)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Glutamate--cysteine ligase catalytic subunit(GCLC) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Image Unavailable-CA10816-812

Anti-GRIA1 Mouse Monoclonal Antibody [clone: N355/1]

Catalog Number: (CA10816-812)
Supplier: Biolegend
Description: GluR1 Monoclonal Antibody, Clone: N355/1, Host: Mouse, Isotype: IgG1, Reactivity: Mouse, Rat, Immunogen: against a fusion protein corresponding to amino acids 1-389 of rat GluA1/GluR1 glutamate receptor, Conjugate: purified, Application: WB, IHC, Size: 100 ul
Product Image-10070-330

Anti-GRIN1 Rabbit Polyclonal Antibody

Catalog Number: (10070-330)
Supplier: Prosci
Description: NMDA receptors are members of the ionotropic class of glutamate receptors, which also includes Kainate and AMPA receptors. NMDA receptors consist of NR1 subunits combined with one or more NR2 (A-D) or NR3 (A-B) subunits. The ligand-gated channel is permeable to cations including Ca2+, and at resting membrane potentials NMDA receptors are inactive due to a voltage-dependent blockade of the channel pore by Mg2+. NMDA receptor activation, which requires binding of glutamate and glycine, leads to an influx of Ca2+ into the postsynaptic region where it activates several signaling cascades, including pathways leading to the induction of long-term potentiation (LTP) and depression (LTD). NMDA receptors have a critical role in excitatory synaptic transmission and plasticity in the CNS. They govern a range of physiological conditions including neurological disorders caused by excitotoxic neuronal injury, psychiatric disorders and neuropathic pain syndromes.
Product Image-89417-782

Anti-GLS2 Rabbit Polyclonal Antibody

Catalog Number: (89417-782)
Supplier: Prosci
Description: GLS2 Antibody: Phosphate-activated glutaminase, also known as Glutaminase 2 (GLS2), was initially isolated from rat liver, although it has been shown to be expressed in other tissues. Like the functionally similar, larger kidney glutaminase, GLS2 catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. Expression of GLS2 is increased by p53 under both stressed and nonstressed conditions, resulting in increased levels of glutamate and alpha-ketoglutarate, which in turn results in enhanced mitochondrial respiration and ATP generation. GLS2 also regulates antioxidant defense function in cells by increasing reduced glutathione levels and decreasing ROS-levels, suggesting that GLS2 acts as a mediator of p53's role in antioxidant defense in addition to its role in energy metabolism.
Image Unavailable-103007-216

Human [Lys22]-beta-Amyloid (1-42)

Catalog Number: (103007-216)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-10111-178

Anti-GRIA2 Rabbit Polyclonal Antibody

Catalog Number: (10111-178)
Supplier: Prosci
Description: GRIA2 is one of the glutamate receptors, which are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with mul
Image Unavailable-10325-668

Anti-NQO1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10325-668)
Supplier: Bioss
Description: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.
Image Unavailable-10663-960

Anti-TAS1R1 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10663-960)
Supplier: Bioss
Description: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate). Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses.
Image Unavailable-10663-962

Anti-TAS1R1 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10663-962)
Supplier: Bioss
Description: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate). Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
609 - 624 of 13,001
no targeter for Bottom