Print…

You Searched For: S-Farnesyl-L-cysteine+methyl+ester


14,142  results were found

Refine Results Sort by
SearchResultCount:"14142"

Sort Results

List View Easy View

Rate These Search Results

Product Image-76704-262

Human Glutamate-Cysteine Ligase Regulatory subunit(GCLM) ELISA Kit

Catalog Number: (76704-262)
Supplier: AFG Bioscience
Description: Human Glutamate-Cysteine Ligase Regulatory subunit(GCLM) ELISA Kit
Product Image-77518-426

Human CCbL1 (Cysteine Conjugate Beta Lyase, Cytoplasmic) ELISA Kit

Catalog Number: (77518-426)
Supplier: AFG Bioscience
Description: Human CCbL1 (Cysteine Conjugate Beta Lyase, Cytoplasmic) ELISA Kit
Image Unavailable-102999-616

Human Cys-beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-10481-416

Anti-PRDX2 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10481-416)
Supplier: Bioss
Description: Peroxiredoxin (Prx) is an antioxidant enzyme detoxifying reactive oxygen species and has a cysteine at the active site. Prx enzymes modulate various receptor signaling pathways and protect cells from oxidatively induced death. Peroxiredoxin 1 to 4 have two conserved Cys residues corresponding to Cys51 and Cys172 of mammalian Peroxiredoxin 1. The active site cysteine(Cys51) is oxidized to cysteine sulfenic acid(Cys51-SOH) when a peroxide is reduced. Because Cys51-SOH is unstable, it forms a disulfide with Cys172-SH which comes from the other subunit of the homodimer. The disulfide is then reduced back to the Prx active thiol form by the thioredoxin-thioredoxin reductase system. However, the formation of the disulfide is a slow process. Thus under oxidative stress conditions, the sulfenic intermediate(Cys51-SOH) can be easily over oxidized to cysteine sulfinic acid(Cys-SO2H) or cysteine sulfonic acid(Cys-SO3H) before it is able to form a disulfide. Recent studies suggest that over oxidized Prx can be reduced back to the active form during recovery after oxidative stress.
Image Unavailable-77436-880

Anti-CCBL1 Rabbit Polyclonal Antibody

Catalog Number: (77436-880)
Supplier: Bioss
Description: Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). Metabolizes the cysteine conjugates of certain halogenated alkenes and alkanes to form reactive metabolites. Catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond.
Product Image-89357-212

Anti-CASP9 Rabbit Polyclonal Antibody

Catalog Number: (89357-212)
Supplier: Genetex
Description: Rabbit polyclonal antibody to Caspase-9 (caspase 9, apoptosis-related cysteine peptidase)
Product Image-77512-924

Human GCLM (Glutamate Cysteine Ligase, Modifier Subunit) ELISA Kit

Catalog Number: (77512-924)
Supplier: AFG Bioscience
Description: Human GCLM (Glutamate Cysteine Ligase, Modifier Subunit) ELISA Kit
Image Unavailable-10391-558

Anti-ATG4D Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10391-558)
Supplier: Bioss
Description: Cysteine protease ATG4D: Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3 and GABARAPL2, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms. Cysteine protease ATG4D, mitochondrial: Plays a role as an autophagy regulator that links mitochondrial dysfunction with apoptosis. The mitochondrial import of ATG4D during cellular stress and differentiation may play important roles in the regulation of mitochondrial physiology, ROS, mitophagy and cell viability.
Image Unavailable-CA95021-822

Glucose Cysteine Agar Base with Thiamine, Dehydrated Culture Media , HiMedia

Catalog Number: (CA95021-822)
Supplier: HiMedia
Description: With added blood or hemoglobin or hemin, it is used for cultivation and enumeration of <i>Pasteurella tularensis</i>

SDS


Product Image-77516-232

Human CYR61 (Cysteine Rich Protein, Angiogenic Inducer 61) ELISA Kit

Catalog Number: (77516-232)
Supplier: AFG Bioscience
Description: Human CYR61 (Cysteine Rich Protein, Angiogenic Inducer 61) ELISA Kit
Image Unavailable-10423-256

Anti-RELM beta Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10423-256)
Supplier: Bioss
Description: The cysteine-rich, adipose tissue-specific, secretory factor resistin (resistance to insulin, also known as ADSF) is a secreted hormone that potentially links obesity to diabetes. Resistin is rich in serine and cysteine residues and contains a unique cysteine repeat motif. Resistin and the resistin-like molecules share the characteristic cysteine composition and other signature features. Resistin-like a is a secreted protein that has restricted tissue distribution and is most highly expressed in adipose tissue. Another family member, Resistin-like b, is a secreted protein expressed only in the gastrointestinal tract, particularly in the colon, in both mouse and human. Resistin-like b expression is highest in proliferative epithelial cells and is markedly increased in tumors, suggesting a role in intestinal proliferation.
Image Unavailable-10423-254

Anti-RELM beta Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10423-254)
Supplier: Bioss
Description: The cysteine-rich, adipose tissue-specific, secretory factor resistin (resistance to insulin, also known as ADSF) is a secreted hormone that potentially links obesity to diabetes. Resistin is rich in serine and cysteine residues and contains a unique cysteine repeat motif. Resistin and the resistin-like molecules share the characteristic cysteine composition and other signature features. Resistin-like a is a secreted protein that has restricted tissue distribution and is most highly expressed in adipose tissue. Another family member, Resistin-like b, is a secreted protein expressed only in the gastrointestinal tract, particularly in the colon, in both mouse and human. Resistin-like b expression is highest in proliferative epithelial cells and is markedly increased in tumors, suggesting a role in intestinal proliferation.
Product Image-77518-084

Mouse GCLM (Glutamate Cysteine Ligase, Modifier Subunit) ELISA Kit

Catalog Number: (77518-084)
Supplier: AFG Bioscience
Description: Mouse GCLM (Glutamate Cysteine Ligase, Modifier Subunit) ELISA Kit
Image Unavailable-B-1530.0025BA

Fmoc-Cys(StBu)-OH

Supplier: Bachem Americas
Description: Sequence: Fmoc-Cys(StBu)-OH

Product Image-77511-126

Mouse SSC4D (Scavenger Receptor Cysteine Rich Family Member with 4 Domains) ELISA Kit

Catalog Number: (77511-126)
Supplier: AFG Bioscience
Description: Mouse SSC4D (Scavenger Receptor Cysteine Rich Family Member with 4 Domains) ELISA Kit
Image Unavailable-10424-042

Anti-CDO1 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10424-042)
Supplier: Bioss
Description: CDO1 (cysteine dioxygenase, type I) is a 200 amino acid protein that belongs to the cysteine dioxygenase family and is involved in organosulfur biosynthesis. Existing as a monomer and expressed at high levels in liver and placenta and at lower levels in brain, pancreas and heart, CDO1 functions as a dioxygenase that uses iron and zinc as cofactors to catalyze the conversion of L-cysteine and oxygen to 3-sulfinoalanine. Via its catalytic activity, CDO1 is involved in pyruvate-, sulfate- and taurine-related metabolic pathways and is a crucial regulator of cysteine concentrations within the cell. Human CDO1 shares 94% amino acid identity with its rat counterpart, suggesting a conserved role between species. The gene encoding CDO1 maps to human chromosome 5, which contains 181 million base pairs and comprises nearly 6% of the human genome. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome, while deletion of the q arm or of chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome.PathwayOrganosulfur biosynthesis; taurine biosynthesis; hypotaurine from L-cysteine: step 1/2.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,153 - 1,168 of 14,142
no targeter for Bottom