You Searched For: Rink+amide+AM+resin


13,527  results were found

Sort Results

List View Easy View
SearchResultCount:"13527"
Description: Bore: 2mm; Plug Size: 11/25; Sidearm OD: 8mm. For replacement or construction of burets having a 1:5 fluoropolymer resin stopcock plug. One arm is pulled to a delivery tip.
Catalog Number: 80074-262
Supplier: Chemglass

Small Business Enterprise


Catalog Number: D-1830.0005BA
Supplier: Bachem Americas


Catalog Number: D-1830.0001BA
Supplier: Bachem Americas


Catalog Number: CAAA42253-A7
Supplier: Thermo Scientific Chemicals

Catalog Number: CAAA42253-A1
Supplier: Thermo Scientific Chemicals

Catalog Number: CAAA42253-30
Supplier: Thermo Scientific Chemicals

Description: Biotin-PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4761.6, Sequence: Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-382
Supplier: Anaspec Inc


Description: H-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) 5g, Substitution 0. 20-0. 49 mmol/g, Storage Condition: -20 +/- 5 degree C.
Catalog Number: D-2885.0005BA
Supplier: Bachem Americas


Description: H-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) 1g, Substitution 0. 20-0. 49 mmol/g, Storage Condition: -20 +/- 5 degree C.
Catalog Number: D-2885.0001BA
Supplier: Bachem Americas


Description: 5mg YIGSR-amide binds to the laminin receptor and inhibits experimental metastasis formation. In comparison to YIGSR (H-6825) ,C-terminal amidation increases the activity of the peptide significantly. CAS: 110590-65-3 C26H43N9O7 FW: 593.68 . Synonym: YIGSR amide
Catalog Number: H-2802.0005BA
Supplier: Bachem Americas


Description: 25mg YIGSR-amide binds to the laminin receptor and inhibits experimental metastasis formation. In comparison to YIGSR (H-6825) ,C-terminal amidation increases the activity of the peptide significantly. CAS: 110590-65-3 C26H43N9O7 FW: 593.68 . Synonym: YIGSR amide
Catalog Number: H-2802.0025BA
Supplier: Bachem Americas


Catalog Number: CAAAA17734-22
Supplier: Thermo Scientific Chemicals

Catalog Number: CAAAA17734-36
Supplier: Thermo Scientific Chemicals

Catalog Number: CAAAA17734-0E
Supplier: Thermo Scientific Chemicals

Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-412
Supplier: Anaspec Inc


Description: DAVISIL* Chromatographic silica resin, 710NW, Pore size: 60A, Particle size: 70-200um, For liquid chromatography, Size: 1kg
Catalog Number: 76183-174
Supplier: W.R. GRACE & CO. - CONN


1,313 - 1,328 of 13,527