You Searched For: Rink+amide+AM+resin


13,527  results were found

Sort Results

List View Easy View
SearchResultCount:"13527"
Description: Neck size(mm-GPI Thread): 43.015" Solid Virgin fluoropolymer resin PTFE. Can be manually inserted into closures of appropriate size
Catalog Number: 16200-444
Supplier: Qorpak

Small Business Enterprise


Catalog Number: 77524-558
Supplier: AFG Bioscience


Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-406
Supplier: Anaspec Inc


Description: Fits Shaft Size: 19mm. Thickness: 0.015in. Opening of either 10 or 19mm to fit Chemglass stirrer shafts. Useful as a dust cover or spacers between the fluoropolymer resin blade and glass foot of standard stirrer shafts. Supplied in packages of 12.
Catalog Number: 80062-292
Supplier: Chemglass

Small Business Enterprise


Description: Fits Shaft Size: 10mm. Thickness: 0.015in. Opening of either 10 or 19mm to fit Chemglass stirrer shafts. Useful as a dust cover or spacers between the fluoropolymer resin blade and glass foot of standard stirrer shafts. Supplied in packages of 12.
Catalog Number: 80062-290
Supplier: Chemglass

Small Business Enterprise


Description: 50ml. Fritted Disc Dia; 25; Overall Height: 195mm; Body O.D; 30mm; GL Thread Size: 25. Solid phase peptide synthesis vessel having a medium porosity, fritted glass resin support.
Catalog Number: 80071-372
Supplier: Chemglass

Small Business Enterprise


Description: 250ml. Fritted Disc Dia; 50; Overall Height: 232mm; Body O.D; 57mm; GL Thread Size: 32. Solid phase peptide synthesis vessel having a medium porosity, fritted glass resin support.
Catalog Number: 80071-376
Supplier: Chemglass

Small Business Enterprise


Description: 10ml. Fritted Disc Dia; 15; Overall Height: 150mm; Body O.D; 18mm; GL Thread Size: 14. Solid phase peptide synthesis vessel having a medium porosity, fritted glass resin support.
Catalog Number: 80071-368
Supplier: Chemglass

Small Business Enterprise


Description: 100ml. Fritted Disc Dia; 40; Overall Height: 183mm; Body O.D; 51mm; GL Thread Size: 25. Solid phase peptide synthesis vessel having a medium porosity, fritted glass resin support.
Catalog Number: 80071-374
Supplier: Chemglass

Small Business Enterprise


Description: 25ml. Fritted Disc Dia; 20; Overall Height: 165mm; Body O.D; 25mm; GL Thread Size: 25. Solid phase peptide synthesis vessel having a medium porosity, fritted glass resin support.
Catalog Number: 80071-370
Supplier: Chemglass

Small Business Enterprise


Description: PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4534.3, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Lyophilized white powder, isolated from bovine hypothalmus, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-262
Supplier: Anaspec Inc


Description: Neck size(mm-GPI Thread): 33-430.015" Solid Virgin fluoropolymer resin PTFE. Can be manually inserted into closures of appropriate size
Catalog Number: 16200-438
Supplier: Qorpak

Small Business Enterprise


Description: Neck size(mm-GPI Thread): 38-430.015" Solid Virgin fluoropolymer resin PTFE. Can be manually inserted into closures of appropriate size
Catalog Number: 16200-442
Supplier: Qorpak

Small Business Enterprise


Description: Glucagon-Like Peptide 1, GLP-1 amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 4469.8, Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, label: FAM, This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm, Size: 0.5 mg
Catalog Number: 102996-394
Supplier: Anaspec Inc


Catalog Number: CA71003-282
Supplier: G-Biosciences

SDS


Description: REPLACEMENT FLUOROPOLYMER RESIN CONES. Set of one each of above listed cones. Made entirely of fluoropolymer resin. Supplied complete with series of 5 all fluoropolymer resin ferrule style cones with inside diameters that run from 3.5 to 6.
Catalog Number: 80060-306
Supplier: Chemglass

Small Business Enterprise


1,265 - 1,280 of 13,527