You Searched For: RITA


24,059  results were found

SearchResultCount:"24059"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76743-576)
Supplier: ANTIBODIES.COM LLC
Description: Monkey S100 beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of monkey S100 beta in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (76741-982)
Supplier: ANTIBODIES.COM LLC
Description: Sheep Inhibin beta B ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of sheep Inhibin beta B in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (76738-458)
Supplier: ANTIBODIES.COM LLC
Description: Rat beta arrestin 1 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of rat beta arrestin 1 in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (77174-744)
Supplier: ANTIBODIES.COM LLC
Description: Human PGC1 beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human PGC1 beta in serum, plasma, and other biological fluids.


Catalog Number: (77526-804)
Supplier: AFG Bioscience
Description: ACTb (Actin Beta) ELISA Kit


Catalog Number: (76739-766)
Supplier: ANTIBODIES.COM LLC
Description: Human beta 2 Microglobulin ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta 2 Microglobulin in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (76734-392)
Supplier: ANTIBODIES.COM LLC
Description: Human Inhibin beta A ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Inhibin beta A in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (77174-908)
Supplier: ANTIBODIES.COM LLC
Description: Mouse RELM beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse RELM beta in serum, plasma, and other biological fluids.


Catalog Number: (77203-414)
Supplier: ANTIBODIES.COM LLC
Description: Human Thymosin beta 4 ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human Thymosin beta 4 in serum, plasma, and other biological fluids.


Catalog Number: (76730-438)
Supplier: ANTIBODIES.COM LLC
Description: Rat TSH beta ELISA kit is a competitive Enzyme-Linked Immunosorbent Assay (cELISA) designed for the <i>in vitro</i> quantitative determination of rat TSH beta in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (77208-072)
Supplier: ANTIBODIES.COM LLC
Description: Mouse Integrin beta 3 ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i><i>in vitro</i></i> quantitative determination of mouse Integrin beta 3 in serum, plasma, and other biological fluids.


Catalog Number: (76742-752)
Supplier: ANTIBODIES.COM LLC
Description: Rat PDGFR beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of rat PDGFR beta in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (76738-166)
Supplier: ANTIBODIES.COM LLC
Description: Mouse HIF1 beta ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse HIF1 beta in serum, plasma, tissue homogenates, and other biological fluids.


Catalog Number: (77207-020)
Supplier: ANTIBODIES.COM LLC
Description: Human beta I Tubulin ELISA kit is a 90 minute sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human beta I Tubulin in serum, plasma, and other biological fluids.


Supplier: Bon Opus Biosciences
Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Catalog Number: (103006-542)
Supplier: Anaspec Inc
Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
977 - 992 of 24,059
no targeter for Bottom