You Searched For: RITA


24,045  results were found

SearchResultCount:"24045"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Bachem Americas
Description: Sequence: H-β-Cyclopropyl-Ala-OH

Supplier: Thermo Scientific Chemicals
Description: β-Chloropropiophenone 96%
Catalog Number: (F-2485.0001BA)
Supplier: Bachem Americas
Description: Sequence: H-β-(3-Benzothienyl)-D-Ala-OH


Catalog Number: (102869-784)
Supplier: R&D Systems
Description: Simple Western


Supplier: Anaspec Inc
Description: This is a salt form of Aβ(1-42) known to form aggregates within a few days in water or recommended solvents. The salt form has been found to form fibrils, exerts cytotoxicity in neuronal models and so, used in studies that evaluate activity of agents that reverse amyloid-induced cytotoxicity.

Catalog Number: (103000-892)
Supplier: Anaspec Inc
Description: Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4198.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103008-452)
Supplier: Anaspec Inc
Description: This peptide is amino acids 3 to 16 fragment of beta-Amyloid (Aß) with an N-terminal deletion that alters the coordination environment for the Cu2+ binding site. Oxidation targets for Aß (1-16) are the histidine residues coordinated to the meta.
Sequence: EFRHDSGYEVHHQK
Molecular Weight: 1768.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (ABCA_AB224215-100U)
Supplier: Abcam
Description: Rabbit polyclonal to FIAT.

New Product


Catalog Number: (ABCA_AB117598-50UG)
Supplier: Abcam
Description: Rabbit polyclonal to CIITA.

New Product


Catalog Number: (10167-946)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to Estrogen-Related Receptor beta


Catalog Number: (10169-698)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to PKC beta II (a.a. 660-673)


Catalog Number: (75788-934)
Supplier: Prosci
Description: Defensins are cationic peptides. It is an important ingredient of the innate immune system. beta -defensins are expressed on some leukocytes and epithelial surfaces. Four human beta -Defensins have been identified to date: BD-1, BD-2, BD-3 and BD-4. beta -defensins contain a six-cysteine motif, they forms three intra-molecular disulfide bonds. beta -defensins are also chemoattractant towards immature dendritic cells and memory T cells. The beta -defensin proteins are expressed as the C-terminal portion of precursors; they are released by proteolytic cleavage of a signal sequence.


Catalog Number: (76077-692)
Supplier: Bioss
Description: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.


Catalog Number: (76079-008)
Supplier: Bioss
Description: Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. PILRB is the non-ITIM-bearing member of the receptor pair, which has a truncated cytoplasmic tail relative to its ITIM-bearing partner and functions in the activating role. There are three named isoforms produced by alternative splicing.


Catalog Number: (76860-782)
Supplier: ANTIBODIES.COM LLC
Description: Rabbit polyclonal antibody to Clathrin light chain for WB with samples derived from Human, Mouse and Rat.


Catalog Number: (102886-980)
Supplier: R&D Systems
Description: Simple Western


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
705 - 720 of 24,045
no targeter for Bottom