You Searched For: Pyridine+N-oxide


6,226  results were found

SearchResultCount:"6226"

Sort Results

List View Easy View

Rate These Search Results

Supplier: MilliporeSigma

SDS

Catalog Number: (77527-418)
Supplier: AFG Bioscience
Description: Human OxHDL (Oxidized high-density lipoprotein) ELISA Kit


Supplier: TCI America
Description: 4-(p-Tolylthio)thieno[2,3-c]pyridine-2-carboxamide, Purity: >95.0%(HPLC), CAS Number: 251992-66-2, Molecular Formula: C15H12N2OS2, Molecular Weight: 300.39, Size: 100MG

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00044639 Beilstein Registry No.: 114377
Supplier: Thermo Scientific Chemicals
Description: In the electronics industry as a liquid encapsulent for Czochralski-type growth of III-V semiconductor single crystals (e.g., GaAs, GaP, InP)
Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00016185
Catalog Number: (76713-672)
Supplier: AFG Bioscience
Description: Human Dimethylaniline Monooxygenase [N-oxide-forming] 1(FMO1) ELISA Kit


Catalog Number: (77514-634)
Supplier: AFG Bioscience
Description: Human NOSTRIN (Nitric Oxide Synthase Trafficker) ELISA Kit


Supplier: TCI America
Description: CAS Number: 524713-66-4
MDL Number: MFCD07775634
Molecular Formula: C15H17N
Molecular Weight: 211.31
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.02

SDS

Catalog Number: (76700-952)
Supplier: AFG Bioscience
Description: Porcine Endothelial Nitric Oxide Synthase 3,eNOS-3 ELISA Kit


Catalog Number: (76706-230)
Supplier: AFG Bioscience
Description: Mouse Endothelial Nitric Oxide Synthase,eNOS ELISA Kit


Supplier: TCI America
Description: 2-Chloro-6-(trichloromethyl)pyridine, CAS Number: 1929-82-4, Purity: 98.0% Pure, Molecular Formula: C6H3Cl4N, Molecular Weight: 230.9 g/mol, Physical Form: Solid, Size: 5G
Supplier: WORLD PRECISION INSTRUMENTS LLC
Description: Accessories for Nitric Oxide Macro Sensor

New Product

Catalog Number: (103007-366)
Supplier: Anaspec Inc
Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00011732 Beilstein Registry No.: 103233 Notes: Filtered through 0.2µ filters. Suitable for spectrophotometry, chromatography. Fieser: 1,958 2,349 4,414 6,497 11,448 12,416
Catalog Number: (77527-528)
Supplier: AFG Bioscience
Description: Chicken AOPP (Advanced Oxidation Protein Products) ELISA Kit


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,057 - 1,072 of 6,226
no targeter for Bottom