You Searched For: Pyridine+N-oxide

6,230 results were found

Refine Results Sort by

Sort Results

List View Easy View

Compare(0) Clear

Rate These Search Results

Human [Met(O)35]-beta-Amyloid (1-42)

Catalog Number: (103007-366)

Supplier: Anaspec Inc

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Retrieving Each

Mn Agar Base Dehydrated Culture Media, HiMedia Laboratories

Catalog Number: (CA95022-234)

Supplier: HiMedia

Description: For the detection of <i>Leptothrix</i> based on ability to oxidize manganous ions.

SDS Certificates

Retrieving Each

5-Bromo-2-hydroxy-3-(trifluoromethyl)pyridine 98%

Supplier: Thermo Scientific Chemicals

Description: 5-Bromo-2-hydroxy-3-(trifluoromethyl)pyridine, Purity: 98%, CAS number: 76041-79-7, Molecular Formula: C6H3BrF3NO, Size: 250mg

SDS Certificates

PAPA NONOate ≥97%

Supplier: Enzo Life Sciences

Description: Nitric oxide (NO) donor.

(±)-α-Lipoic acid ≥99%, Calbiochem®, Sigma-Aldrich®

Catalog Number: (CA80058-320)

Supplier: MilliporeSigma

Description: Oxidized form

Certificates

Retrieving Each

Anti-PRDX2 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10481-408)

Supplier: Bioss

Description: Peroxiredoxin (Prx) is an antioxidant enzyme detoxifying reactive oxygen species and has a cysteine at the active site. Prx enzymes modulate various receptor signaling pathways and protect cells from oxidatively induced death. Peroxiredoxin 1 to 4 have two conserved Cys residues corresponding to Cys51 and Cys172 of mammalian Peroxiredoxin 1. The active site cysteine(Cys51) is oxidized to cysteine sulfenic acid(Cys51-SOH) when a peroxide is reduced. Because Cys51-SOH is unstable, it forms a disulfide with Cys172-SH which comes from the other subunit of the homodimer. The disulfide is then reduced back to the Prx active thiol form by the thioredoxin-thioredoxin reductase system. However, the formation of the disulfide is a slow process. Thus under oxidative stress conditions, the sulfenic intermediate(Cys51-SOH) can be easily over oxidized to cysteine sulfinic acid(Cys-SO2H) or cysteine sulfonic acid(Cys-SO3H) before it is able to form a disulfide. Recent studies suggest that over oxidized Prx can be reduced back to the active form during recovery after oxidative stress.

Retrieving Each

1,8-Bis(diphenylphosphinyl)naphthalene ≥98.0% (by HPLC)

Supplier: TCI America

Description: 1,8-Bis(diphenylphosphinyl)naphthalene, Purity: >98%(HPLC), CAS no: 316808-41-0, MF: C34H26O2P2, Molecular Weight: 528.53, Synonyms: Naphthalene-1,8-diylbis(diphenylphosphine Oxide), Form: Crystal- Powder, Very pale yellow - Yellow, Size: 5G

Zinc titanate ≥99.9% (metals basis)

Supplier: Thermo Scientific Chemicals

Description: Zinc titanate ≥99.9% (metals basis)

Certificates

Anti-OXSR1 Rabbit Polyclonal Antibody

Catalog Number: (10814-018)

Supplier: Prosci

Description: Oxidative-stress responsive 1 gene is located in the vicinity of three others genes - GOLGA4, ITGA9 and HYA22 on chromosome 3. These four genes are considered to be candidate tumor suppressors. Oxidative-stress responsive 1 protein has similarity to human Ste20/oxidant stress response kinase-1 and is thought to be involved in the response to oxidative stress

Retrieving Each

Human Lectin-like Oxidized low density Lipoprotein Receptor 1(LOX1) ELISA Kit

Catalog Number: (76716-110)

Supplier: AFG Bioscience

Description: Human Lectin-like Oxidized low density Lipoprotein Receptor 1(LOX1) ELISA Kit

Retrieving Each

PYREX® Mallory Direct Reading Settlometer, Corning

Catalog Number: (26307-604)

Supplier: Corning

Description: Used with oxidized sludge process for treatment of sewage and other wastes. These cylinders are graduated in cc per litre and in hundredths of a foot.

Certificates

Retrieving Case

ß-Nicotinamide adenine dinucleotide phosphate (NADP-Na2, oxidized form) ≥98%, white powder

Catalog Number: (IC0210116625)

Supplier: MP Biomedicals

Description: β-NADP is a coenzyme necessary for the alcoholic fermentation of glucose and the oxidative dehydrogenation of other substances. It occurs widely in living tissue, especially in the liver. Nicotinic acid can be converted to nicotinamide in the body and, in this form, is found as a component of two oxidation-reduction coenzymes: nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucleotide phosphate (NADP). The nicotinamide portion of the coenzyme transfers hydrogens by alternating between oxidized quaternary nitrogen and a reduced tertiary nitrogen. NADP is an essential coenzyme for glucose-6-phosphate dehydrogenase which catalyzes the oxidation of glucose-6-phosphate to 6-phosphogluconic acid. This reaction initiates metabolism of glucose by a pathway other than the citric acid cycle. This route is known as the hexose phosphate shunt or phosphogluconate pathway. Other enzymes which utilize NADP as a coenzyme are: Alcohol dehydrogenase:NADP dependent; Aromatic ADH:NADP dependent; Ferredoxin-NADP reductase; L-Fucose dehydrogenase; Gabase; Galactose-1-phosphate uridyl transferase; Glucose dehydrogenase; L-Glutamic dehydrogenase; Glycerol dehydrogenase:NADP specific; Isocitric dehydrogenase; Malic enzymes; 5,10-Methylenetetrahydrofolate dehydrogenase; 6-Phosphogluconate dehydrogenase and Succinic semialdehyde dehydrogenase.