You Searched For: Pyridine+N-oxide


6,230  results were found

SearchResultCount:"6230"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103007-366)
Supplier: Anaspec Inc
Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (CA95022-234)
Supplier: HiMedia
Description: For the detection of <i>Leptothrix</i> based on ability to oxidize manganous ions.

Supplier: Thermo Scientific Chemicals
Description: 5-Bromo-2-hydroxy-3-(trifluoromethyl)pyridine, Purity: 98%, CAS number: 76041-79-7, Molecular Formula: C6H3BrF3NO, Size: 250mg
Supplier: Enzo Life Sciences
Description: Nitric oxide (NO) donor.

Catalog Number: (CA80058-320)
Supplier: MilliporeSigma
Description: Oxidized form

Catalog Number: (10481-408)
Supplier: Bioss
Description: Peroxiredoxin (Prx) is an antioxidant enzyme detoxifying reactive oxygen species and has a cysteine at the active site. Prx enzymes modulate various receptor signaling pathways and protect cells from oxidatively induced death. Peroxiredoxin 1 to 4 have two conserved Cys residues corresponding to Cys51 and Cys172 of mammalian Peroxiredoxin 1. The active site cysteine(Cys51) is oxidized to cysteine sulfenic acid(Cys51-SOH) when a peroxide is reduced. Because Cys51-SOH is unstable, it forms a disulfide with Cys172-SH which comes from the other subunit of the homodimer. The disulfide is then reduced back to the Prx active thiol form by the thioredoxin-thioredoxin reductase system. However, the formation of the disulfide is a slow process. Thus under oxidative stress conditions, the sulfenic intermediate(Cys51-SOH) can be easily over oxidized to cysteine sulfinic acid(Cys-SO2H) or cysteine sulfonic acid(Cys-SO3H) before it is able to form a disulfide. Recent studies suggest that over oxidized Prx can be reduced back to the active form during recovery after oxidative stress.


Supplier: TCI America
Description: 1,8-Bis(diphenylphosphinyl)naphthalene, Purity: >98%(HPLC), CAS no: 316808-41-0, MF: C34H26O2P2, Molecular Weight: 528.53, Synonyms: Naphthalene-1,8-diylbis(diphenylphosphine Oxide), Form: Crystal- Powder, Very pale yellow - Yellow, Size: 5G

Supplier: Thermo Scientific Chemicals
Description: Zinc titanate ≥99.9% (metals basis)
Catalog Number: (10814-018)
Supplier: Prosci
Description: Oxidative-stress responsive 1 gene is located in the vicinity of three others genes - GOLGA4, ITGA9 and HYA22 on chromosome 3. These four genes are considered to be candidate tumor suppressors. Oxidative-stress responsive 1 protein has similarity to human Ste20/oxidant stress response kinase-1 and is thought to be involved in the response to oxidative stress


Catalog Number: (76716-110)
Supplier: AFG Bioscience
Description: Human Lectin-like Oxidized low density Lipoprotein Receptor 1(LOX1) ELISA Kit


Catalog Number: (26307-604)
Supplier: Corning
Description: Used with oxidized sludge process for treatment of sewage and other wastes. These cylinders are graduated in cc per litre and in hundredths of a foot.

Catalog Number: (IC0210116625)
Supplier: MP Biomedicals
Description: β-NADP is a coenzyme necessary for the alcoholic fermentation of glucose and the oxidative dehydrogenation of other substances. It occurs widely in living tissue, especially in the liver. Nicotinic acid can be converted to nicotinamide in the body and, in this form, is found as a component of two oxidation-reduction coenzymes: nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucleotide phosphate (NADP). The nicotinamide portion of the coenzyme transfers hydrogens by alternating between oxidized quaternary nitrogen and a reduced tertiary nitrogen. NADP is an essential coenzyme for glucose-6-phosphate dehydrogenase which catalyzes the oxidation of glucose-6-phosphate to 6-phosphogluconic acid. This reaction initiates metabolism of glucose by a pathway other than the citric acid cycle. This route is known as the hexose phosphate shunt or phosphogluconate pathway. Other enzymes which utilize NADP as a coenzyme are: Alcohol dehydrogenase:NADP dependent; Aromatic ADH:NADP dependent; Ferredoxin-NADP reductase; L-Fucose dehydrogenase; Gabase; Galactose-1-phosphate uridyl transferase; Glucose dehydrogenase; L-Glutamic dehydrogenase; Glycerol dehydrogenase:NADP specific; Isocitric dehydrogenase; Malic enzymes; 5,10-Methylenetetrahydrofolate dehydrogenase; 6-Phosphogluconate dehydrogenase and Succinic semialdehyde dehydrogenase.


Supplier: Thermo Scientific Chemicals
Description: 3-(Trifluoromethyl)pyridine 97%
Supplier: Thermo Scientific Chemicals
Description: 4-(3-Phenylpropyl)pyridine 98%
Catalog Number: (77525-242)
Supplier: AFG Bioscience
Description: Cattle LOX1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit


Catalog Number: (77513-874)
Supplier: AFG Bioscience
Description: Human LOX1 (Lectin Like Oxidized Low Density Lipoprotein Receptor 1) ELISA Kit


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
977 - 992 of 6,230
no targeter for Bottom