Print…

You Searched For: Protein+Purification+Resins


155,766  results were found

Refine Results Sort by
SearchResultCount:"155766"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-77134-368

Human Recombinant Her2 Protein (from HEK293 Cells)

Catalog Number: (77134-368)
Supplier: Prosci
Description: Human Recombinant Her2 Protein (from HEK293 Cells)
Image Unavailable-77125-738

SARS-CoV-2 Recombinant ORF9B Protein (from Bacteria)

Catalog Number: (77125-738)
Supplier: Prosci
Description: SARS-CoV-2 Recombinant ORF9B Protein (from Bacteria)
Image Unavailable-77130-528

Human Recombinant PVRIG Protein (from HEK293 cells)

Catalog Number: (77130-528)
Supplier: Prosci
Description: Human Recombinant PVRIG Protein (from HEK293 cells)
Image Unavailable-77132-784

Human Recombinant IL-37 Protein (from E. coli)

Catalog Number: (77132-784)
Supplier: Prosci
Description: Human Recombinant IL-37 Protein (from <i>E. coli</i>)
Image Unavailable-77130-390

Human Recombinant HGF Protein (from HEK293 cells)

Catalog Number: (77130-390)
Supplier: Prosci
Description: Human Recombinant HGF Protein (from HEK293 cells)
Image Unavailable-77122-438

Mouse Recombinant Galectin-4 Protein (from HEK293 Cells)

Catalog Number: (77122-438)
Supplier: Prosci
Description: Mouse Recombinant Galectin-4 Protein (from HEK293 Cells)
Image Unavailable-102943-578

Human Recombinant Endoplasmic Reticulum Resident Protein 27

Supplier: Bon Opus Biosciences
Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Image Unavailable-D-2885.0005BA

H-Asn(Trt)-2-Chlorotrityl, Bachem

Supplier: Bachem Americas
Description: H-Asn(Trt)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) 1g, Substitution 0. 20-0. 49 mmol/g, Storage Condition: -20 +/- 5 degree C.

Image Unavailable-77020-328

ZymoPURE™ Wash Buffer 1

Catalog Number: (77020-328)
Supplier: Zymo Research
Description: Wash buffer designed to be used with our ZymoPURE™ Plasmid Purification Kits.
Image Unavailable-77133-864

Human Recombinant PDGF-B Protein (from E. coli)

Catalog Number: (77133-864)
Supplier: Prosci
Description: Human Recombinant PDGF-B Protein (from <i>E. coli</i>)
Image Unavailable-H-5494.0500BA

Human;Mouse;Rat pTH-Related Protein (1-37) Trifluoroacetate

Supplier: Bachem Americas
Description: pTHrP (1-37) is a parathyroid hormone-related protein sequence implicated in malignant hypercalcemia.

Image Unavailable-103007-180

Beta-Amyloid A4 Protein Precursor (740-770)

Catalog Number: (103007-180)
Supplier: Anaspec Inc
Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-77131-618

HSV-1 Recombinant gD Protein (from P. pastoris)

Catalog Number: (77131-618)
Supplier: Prosci
Description: HSV-1 Recombinant gD Protein (from <i>P. pastoris</i>)
Image Unavailable-77127-936

Hepatitis C Recombinant NS5a Protein (from E. coli)

Catalog Number: (77127-936)
Supplier: Prosci
Description: Hepatitis C Recombinant NS5a Protein (from <i>E. coli</i>)
Image Unavailable-77119-662

Mouse Recombinant BD-2 Protein (from E. coli)

Catalog Number: (77119-662)
Supplier: Prosci
Description: Mouse Recombinant BD-2 Protein (from <i>E. coli</i>)
Image Unavailable-77128-016

Human Recombinant FKBP12 Protein (from E. coli)

Catalog Number: (77128-016)
Supplier: Prosci
Description: Human Recombinant FKBP12 Protein (from <i>E. coli</i>)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
673 - 688 of 155,766
no targeter for Bottom