Print…

You Searched For: Cork+Borers


66,655  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"66655"

Rate These Search Results

Image Unavailable-10062-162

Liver Tumor Lysate, ProSci Inc

Description: Liver tumor tissue lysate (1330) was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Catalog Number: 10062-162
Supplier: Prosci
Image Unavailable-103010-348

AnaTag™ HiLyte™ Fluor 750 Microscale Protein Labeling Kit *Ultra Convenient*, Anaspec

Description: HiLyte™ Fluor 750 acid, SE is the longest-wavelength amine-reactive HiLyte™ Fluor dye currently available. Its fluorescence emission maximum at 778 nm is well separated from commonly used far-red fluorophores such as HiLyte™ Fluor 647, HiLyte™ Fluor 680 or allophycocyanin (APC), facilitating multicolor analysis.
Catalog Number: 103010-348
Supplier: Anaspec Inc
Image Unavailable-25607-608

Tissue Forceps, Walter Stern Inc

Description: Stainless steel
Catalog Number: 25607-608
Supplier: Walter Stern
Product Image-68400-590

Tape Dispensers, Micronova Manufacturing Inc.

Description: Designed for use with Micronova tapes
Catalog Number: 68400-590
Supplier: Micronova

Small Business Enterprise Minority or Woman-Owned Business Enterprise


Product Image-10199-808

Objective Thermal Spacers, Bioptechs Inc.®

Description: These 9 mm thick internally and externally threaded polymer rings are to be placed between an objective and nosepiece to inhibit thermal conductivity.
Catalog Number: 10199-808
Supplier: BIOPTECHS INC.
Product Image-10199-788

FCS3® Stage Adapters, Bioptechs Inc.®

Description: FCS3® Stage Adapters consist of a black anodized aluminum plate containing a circuit board and electrical connectors that accept the FCS3® and interface a variety of upright microscope stages.
Catalog Number: 10199-788
Supplier: BIOPTECHS INC.
Product Image-10200-030

Objective Heater® System, Bioptechs Inc.®

Description: A small, cube-shaped device containing a heating band, fastening loop, and thermal sensor that is designed to attach to a microscope objective to prevent heat loss from the specimen when using high numeric aperture lenses.
Catalog Number: 10200-030
Supplier: BIOPTECHS INC.
Image Unavailable-103010-638

AggreSure™ Human Beta-Amyloid (1-40)

Description: AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103010-638
Supplier: Anaspec Inc
Product Image-10200-008

FCS2® Temperature Controller, Bioptechs Inc.®

Description: The FCS2® Temperature Controller is an electronic controller used with the FCS2® chamber to maintain uniform temperature, from ambient to 50 °C.
Catalog Number: 10200-008
Supplier: BIOPTECHS INC.
Product Image-10200-052

FCS2® Stage Adapters, Bioptechs Inc.®

Description: An assortment of FCS2® stage adapters, each consisting of an aluminum plate designed to enable precise positioning
Catalog Number: 10200-052
Supplier: BIOPTECHS INC.
Product Image-10199-802

Objective Thermal Isolators, Bioptechs Inc.®

Description: These 9 mm thick internally and externally threaded polymer rings are to be placed between an objective and nosepiece to inhibit thermal conductivity.
Catalog Number: 10199-802
Supplier: BIOPTECHS INC.
Product Image-10199-872

ICD Heated Lid, Bioptechs Inc.®

Description: This O-Ring sealed, stainless steel insert is equipped with a heated glass window to prevent condensation and atmospherically seal an ICD.
Catalog Number: 10199-872
Supplier: BIOPTECHS INC.
Product Image-10200-036

Glass Coverslips, 22mm, Bioptechs Inc.®

Description: Desag 263 German glass coverslips with a 22 mm diameter.
Catalog Number: 10200-036
Supplier: BIOPTECHS INC.
Image Unavailable-10062-164

Lymphoma Tumor Lysate, ProSci Inc

Description: Lymphoma tumor tissue lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Catalog Number: 10062-164
Supplier: Prosci
Image Unavailable-10062-192

Lymph Node Lysate, ProSci Inc

Description: Lymph Node tissue lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Catalog Number: 10062-192
Supplier: Prosci
Image Unavailable-10062-186

Frontal Lobe Lysate, ProSci Inc

Description: Frontal Lobe tissue lysate was prepared by homogenization in lysis buffer (10 mM HEPES pH7.9, 1.5 mM MgCl<sub>2</sub>, 10 mM KCl, 1 mM ethylenediaminetetraacetic acid, 10% glycerol, 1% NP-40, and a cocktail of protease inhibitors)
Catalog Number: 10062-186
Supplier: Prosci
545 - 560 of 66,655