Print…

You Searched For: Pifithrin-\u03B1+(cyclic)+hydrobromide


1,199  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1199"

Rate These Search Results

Image Unavailable-76100-778

PAB RAB DEF1 DEFENSIN 1 HU AF680 100UL

Catalog Number: 76100-778
Supplier: Bioss
Image Unavailable-10390-088

ADCY7 ANTIBODY

Catalog Number: 10390-088
Supplier: Bioss
Image Unavailable-103006-396

Cyclo (-RGDyK)

Description: Cyclo (-RGDyK)
Catalog Number: 103006-396
Supplier: Anaspec Inc
Product Image-10107-914

SERBP1 Antibody

Description: Polyclonal, Host: Rabbit; Species reactivity: Human, Mouse, Rat, Dog; Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human SERBP1; Purified by peptide affinity chromatography method; Applications: Elisa, Western blotting
Catalog Number: 10107-914
Supplier: Prosci
Image Unavailable-CAAAAL12958-22

39-BIS(11-DIMETHL-2-HY 97 100G

Catalog Number: CAAAAL12958-22
Supplier: Thermo Scientific Chemicals
Image Unavailable-CAAAAL12958-14

39-BIS(11-DIMETHL-2-HYD 97 25G

Catalog Number: CAAAAL12958-14
Supplier: Thermo Scientific Chemicals
Image Unavailable-CA80051-960

Guanosine-3',5'-cyclicmonophosphoric acid sodium salt

Description: Guanosine-3',5'-cyclicmonophosphoric acid sodium salt
Catalog Number: CA80051-960
Supplier: MilliporeSigma

Certificates


Image Unavailable-76116-186

BST1 Polyclonal Antibody 100ul

Description: BST1 Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species Reactivity: Human, Mouse, Rat, Conjugate: Alexa Fluor 680, Source: KLH conjugated synthetic peptide derived from human BST1 Synonyms: BST 1, BST1, BST-1, Application: IHC-P, IF(IHC-P), Size: 100ul
Catalog Number: 76116-186
Supplier: Bioss
Product Image-76310-448

PAB Rabbit ATF6 Human IgG 25 uL

Description: ATF6, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: shows 100% identity with human and 80% identity to rat, Synonyms: Cyclic AMP-dependent transcription factor ATF-6 alpha, Activating transcription factor 6 alpha, ATF6 a, Size: 25 uL
Catalog Number: 76310-448
Supplier: Rockland Immunochemical
Product Image-KT420160-0000

NMR Funnel Polypropylene

Description: Funnel Set (Unassembled) Polypropylene construction with a lower fitting sized to accommodate 5 mm NMR tubes. Disposable feature eliminates the possibility of cross contamination. Filter is a polyethylene disc or glass wool.
Catalog Number: KT420160-0000
Supplier: DWK Life Sciences (KIMBLE)
Image Unavailable-102998-450

Calcitonin, human 5mg

Description: Calcitonin, human, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 3417.9, Sequence (One-Letter Code): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7), Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, Size: 5mg
Catalog Number: 102998-450
Supplier: Anaspec Inc
Image Unavailable-76081-430

RASA3 Polyclonal antibody 100ul

Description: RASA3 Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 680, Immunogen: KLH conjugated synthetic peptide derived from RASA3, Synonyms: GAP1IP4BP, Ras GTPase-activating prot
Catalog Number: 76081-430
Supplier: Bioss
Product Image-10141-224

VIOLETFLUOR 450 ANTI-HUMAN CD38 (HIT2)

Catalog Number: 10141-224
Supplier: Tonbo Biosciences
Image Unavailable-103006-352

Cyclo ( - GRGDSP) N to C cyclized 5 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-352
Supplier: Anaspec Inc
Image Unavailable-103006-350

Cyclo ( - GRGDSP) N to C cyclized 1 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-350
Supplier: Anaspec Inc
Image Unavailable-76100-780

PAB RAB DEF1 DEFENSIN 1 HU AF750 100UL

Catalog Number: 76100-780
Supplier: Bioss
369 - 384 of 1,199