Print…

You Searched For: Pifithrin-\u03B1+(cyclic)+hydrobromide


1,198  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1198"

Rate These Search Results

Product Image-76310-448

PAB Rabbit ATF6 Human IgG 25 uL

Description: ATF6, Polyclonal antibody, Host: Rabbit, Species: Human, Isotype: IgG, Immunogen: shows 100% identity with human and 80% identity to rat, Synonyms: Cyclic AMP-dependent transcription factor ATF-6 alpha, Activating transcription factor 6 alpha, ATF6 a, Size: 25 uL
Catalog Number: 76310-448
Supplier: Rockland Immunochemical
Image Unavailable-10427-102

RASA3 Antibody

Description: RASA3 Polyclonal Antibody, Host: Rabbit , Cy5.5 Conjugated, Emmission: 675nm/694nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: GAPIII; GAP1IP4BP, Application: IF(IHC-P), 100ul
Catalog Number: 10427-102
Supplier: Bioss
Image Unavailable-10427-106

RASA3 Antibody

Description: RASA3 Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: GAPIII; GAP1IP4BP, Application: IF(IHC-P), 100ul
Catalog Number: 10427-106
Supplier: Bioss
Image Unavailable-CA80051-960

Guanosine-3',5'-cyclicmonophosphoric acid sodium salt

Description: Guanosine-3',5'-cyclicmonophosphoric acid sodium salt
Catalog Number: CA80051-960
Supplier: MilliporeSigma

Certificates


Image Unavailable-CAPIPA5-18965

MRP5 Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (KDIDIGKEYIIP) corresponding to the N-terminus amino acids of ABCC5
Catalog Number: CAPIPA5-18965
Supplier: Thermo Scientific
Image Unavailable-CA80503-696

β-Cyclodextrine ≥98% (by HPLC), Calbiochem®, Millipore®

Description: β-Cyclodextrine ≥98% (by HPLC), Calbiochem®, Millipore®
Catalog Number: CA80503-696
Supplier: MilliporeSigma

Certificates


Image Unavailable-10390-080

ADCY7 ANTIBODY

Catalog Number: 10390-080
Supplier: Bioss
Product Image-89157-044

Rp-8-Br-Cgmps 500 ug

Catalog Number: 89157-044
Supplier: Enzo Life Sciences
Product Image-10107-912

SERBP1 Antibody

Description: Polyclonal, Host: Rabbit; Species reactivity: Human, Mouse, Rat; Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human SERBP1; Purified by peptide affinity chromatography method; Applications: Elisa, Western blotting
Catalog Number: 10107-912
Supplier: Prosci
Image Unavailable-102998-450

Calcitonin, human 5mg

Description: Calcitonin, human, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 3417.9, Sequence (One-Letter Code): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7), Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, Size: 5mg
Catalog Number: 102998-450
Supplier: Anaspec Inc
Image Unavailable-89367-356

Rabbit Polyclonal antibody to PDE8B (phosphodiesterase 8B)

Description: Purity: Immunogen affinity purified Species Reactivity: Human, Mouse, Rat Tested Applications: IP, WB Pkg Size: 100 ug
Catalog Number: 89367-356
Supplier: Genetex
Image Unavailable-103006-352

Cyclo ( - GRGDSP) N to C cyclized 5 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-352
Supplier: Anaspec Inc
Image Unavailable-103006-350

Cyclo ( - GRGDSP) N to C cyclized 1 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-350
Supplier: Anaspec Inc
Product Image-10141-224

VIOLETFLUOR 450 ANTI-HUMAN CD38 (HIT2)

Catalog Number: 10141-224
Supplier: Tonbo Biosciences
Product Image-10110-858

PDE1A Antibody

Description: Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, rat, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human PDE1A, purified by peptide affinity chromatography method, Application: ELISA, western blot.
Catalog Number: 10110-858
Supplier: Prosci
Product Image-89157-014

Rp-Camps 1 Mg

Catalog Number: 89157-014
Supplier: Enzo Life Sciences
369 - 384 of 1,198