Print…

You Searched For: Pifithrin-\\\\u03B1+(cyclic)+hydrobromide


1,199  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1199"

Rate These Search Results

Product Image-89157-044

Rp-8-Br-Cgmps 500 ug

Catalog Number: 89157-044
Supplier: Enzo Life Sciences
Image Unavailable-102998-448

Human Calcitonin Peptide

Description: Human Calcitonin Peptide
Catalog Number: 102998-448
Supplier: Anaspec Inc
Image Unavailable-102998-450

Calcitonin, human 5mg

Description: Calcitonin, human, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 3417.9, Sequence (One-Letter Code): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7), Appearance: Lyophilized white powder, Peptide Reconstitution: freely soluble in water, Size: 5mg
Catalog Number: 102998-450
Supplier: Anaspec Inc
Product Image-10106-444

ANXA3 Antibody

Description: Polyclonal, Host:Rabbit, Species reactivity:Human, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human ANXA3, purified by protein A chromatography method, Application:Elisa
Catalog Number: 10106-444
Supplier: Prosci
Image Unavailable-H-2166.1000BA

UROGUANYLIN (HUMAN)

Description: 1mg Uroguanylin belongs to the guanylin family of cyclic guanosine monophosphate (cGMP) regulating peptides. This family of peptides shows homology to the heat stable enterotoxins produced by strains of Escherichia coli and other enteric bacteria that cause a secretory form of diarrhea. Along with the isolation of uroguanylin from urine and the subsequent demonstration of its natriuretic activity by direct effects on the kidney, uroguanylin has been sug gested to play a role in the physiological maintenance of sodium balance in vivo. (Disulfide bonds between Cys4 and Cys12/Cys7 and Cys15) CAS: 154525-25-4 C64H102N18O26S4 FW: 1667.88 . Synonym: ug N (human)
Catalog Number: H-2166.1000BA
Supplier: Bachem Americas
Image Unavailable-H-2166.0500BA

UROGUANYLIN (HUMAN)

Description: 0.5mg Uroguanylin belongs to the guanylin family of cyclic guanosine monophosphate (cGMP) regulating peptides. This family of peptides shows homology to the heat stable enterotoxins produced by strains of Escherichia coli and other enteric bacteria that cause a secretory form of diarrhea. Along with the isolation of uroguanylin from urine and the subsequent demonstration of its natriuretic activity by direct effects on the kidney, uroguanylin has been sug gested to play a role in the physiological maintenance of sodium balance in vivo. (Disulfide bonds between Cys4 and Cys12/Cys7 and Cys15) CAS: 154525-25-4 C64H102N18O26S4 FW: 1667.88 . Synonym: ug N (human)
Catalog Number: H-2166.0500BA
Supplier: Bachem Americas
Image Unavailable-89367-424

Rat Monoclonal antibody to MRP4 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4)

Description: Clone: M4I-10 Purity: Tissue culture supernatant Species Reactivity: Human, Mouse Tested Applications: FACS, ICC/IF, IHC-Fr, WB Pkg Size: 500 ul
Catalog Number: 89367-424
Supplier: Genetex
Product Image-10100-746

GRM6 Antibody

Description: Polyclonal, Host:Rabbit, Species reactivity:human dog mouse rat, Immunogen:produced in rabbits immunized with a synthetic peptide corresponding a region of human GRM6, purified by peptide affinity chromatography method, Application:Elisa, 50ug
Catalog Number: 10100-746
Supplier: Prosci
Product Image-10106-446

ANXA3 Antibody

Description: Polyclonal, Host:Rabbit, Species reactivity:Human, Dog, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human ANXA3, purified by protein A chromatography method, Application:Elisa
Catalog Number: 10106-446
Supplier: Prosci
Image Unavailable-CAPIPA5-18459

PDE4D Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (QPEACVIDDRSPDT) corresponding to the C-terminus amino acids of PDE4D
Catalog Number: CAPIPA5-18459
Supplier: Thermo Scientific
Image Unavailable-H-1382.0001BA

ENDOTOXIN INHIBITOR

Description: 1mg The cyclic peptide KTKCKFLKKC has ben shown to form a strong complex with lipid A, the toxic component of the endotoxin lipopolysaccharide (LPS) with Ka = 0.56 · 107 M-1. It detoxifies LPS in vitro and prevents LPS-induced cytokine release and lethality in vivo. Furthermore, it shows neither antibiotic activity nor toxicity and might therefore be useful in the prophylaxis and treatment of LPS-mediated diseases.
KTKCKFLKKC bears a structural resemblance to the peptide antibiotic and endotoxin inhibitor polymyxin B. It could be of use as an adjuvant for antibiotic therapy. (Disulfide bond) CAS: 147396-10-9 C55H97N15O12S2 FW: 1226.62 . endotoxin inhibitor
Catalog Number: H-1382.0001BA
Supplier: Bachem Americas
Image Unavailable-H-1382.0005BA

ENDOTOXIN INHIBITOR

Description: 5mg The cyclic peptide KTKCKFLKKC has ben shown to form a strong complex with lipid A, the toxic component of the endotoxin lipopolysaccharide (LPS) with Ka = 0.56 · 107 M-1. It detoxifies LPS in vitro and prevents LPS-induced cytokine release and lethality in vivo. Furthermore, it shows neither antibiotic activity nor toxicity and might therefore be useful in the prophylaxis and treatment of LPS-mediated diseases.
KTKCKFLKKC bears a structural resemblance to the peptide antibiotic and endotoxin inhibitor polymyxin B. It could be of use as an adjuvant for antibiotic therapy. (Disulfide bond) CAS: 147396-10-9 C55H97N15O12S2 FW: 1226.62 . endotoxin inhibitor
Catalog Number: H-1382.0005BA
Supplier: Bachem Americas
Product Image-89357-970

Rabbit Polyclonal antibody to Annexin III (annexin A3)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89357-970
Supplier: Genetex
Image Unavailable-89359-558

Rabbit Polyclonal antibody to GPRC1C

Description: Purity: Immunogen affinity purified Species Reactivity: Human Tested Applications: ICC/IF, IHC-P Pkg Size: 25 ug
Catalog Number: 89359-558
Supplier: Genetex
Image Unavailable-103006-396

Cyclo (-RGDyK)

Description: Cyclo (-RGDyK)
Catalog Number: 103006-396
Supplier: Anaspec Inc
Image Unavailable-CAPIPA5-18965

MRP5 Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (KDIDIGKEYIIP) corresponding to the N-terminus amino acids of ABCC5
Catalog Number: CAPIPA5-18965
Supplier: Thermo Scientific
417 - 432 of 1,199