You Searched For: N-Fmoc-glycine


5,064  results were found

Sort Results

List View Easy View
SearchResultCount:"5064"
Catalog Number: B-1345.0025BA
Supplier: Bachem Americas


Catalog Number: B-1345.0500BA
Supplier: Bachem Americas


Catalog Number: B-1345.0100BA
Supplier: Bachem Americas


Description: Fmoc-Tle-OH.
Catalog Number: B-2110.0001BA
Supplier: Bachem Americas


Description: Fmoc-Tle-OH.
Catalog Number: B-2110.0025BA
Supplier: Bachem Americas


Description: Fmoc-Tle-OH.
Catalog Number: B-2110.0005BA
Supplier: Bachem Americas


Catalog Number: B-1335.0025BA
Supplier: Bachem Americas


Catalog Number: B-1335.0005BA
Supplier: Bachem Americas


Catalog Number: B-1335.0001BA
Supplier: Bachem Americas


Description: Rabbit Polyclonal antibody to SLC6A5 (solute carrier family 6 (neurotransmitter transporter glycine) member 5) Purity: Peptide Affinity Purified Species Reactivity: Human Tested Applications: WB Pkg Size: 50 ug
Catalog Number: 89269-780
Supplier: Genetex


Description: [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4442.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-114
Supplier: Anaspec Inc


Description: Polyclonal, Host: Rabbit; Species Reactivity: Rat, Canine, Bovine; Immunogen: Peptide corresponding to amino acid residues from the N-terminal region of rat Vesicular GABA Amino Acid Transporter (VGAT); Tested Applications: WB
Catalog Number: 10075-584
Supplier: Prosci


Description: Fmoc-D-Orn(carbamoyl)-OH.
Catalog Number: B-2075.0001BA
Supplier: Bachem Americas


Description: Fmoc-D-Orn(carbamoyl)-OH.
Catalog Number: B-2075.0005BA
Supplier: Bachem Americas


Catalog Number: B-1665.0005BA
Supplier: Bachem Americas


Catalog Number: B-1665.0001BA
Supplier: Bachem Americas


753 - 768 of 5,064