Print…

You Searched For: N-Benzoyl-L-glutamic+acid


102,268  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"102268"

Rate These Search Results

Image Unavailable-10349-406

GGT1 Antibody

Description: GGT1 Polyclonal Antibody, Host: Rabbit, Cy7 Conjugated, Emmission: 743nm/767nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Elk4; ELK4_HUMAN; ETS domain containing protein Elk4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10349-406
Supplier: Bioss
Image Unavailable-10349-410

GGT1 Antibody

Description: GGT1 Polyclonal Antibody, Host: Rabbit, HRP Conjugated, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Elk4; ELK4_HUMAN; ETS domain containing protein Elk4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10349-410
Supplier: Bioss
Image Unavailable-89268-810

RB PAB to SH3BGRL

Description: Rabbit Polyclonal antibody to SH3BGRL (SH3 domain binding glutamic acid-rich protein like) Purity: Peptide Affinity Purified Species Reactivity: Human Mouse Rat Tested Applications: WB Pkg Size: 50 ug
Catalog Number: 89268-810
Supplier: Genetex
Image Unavailable-10082-302

Anti-ARC/ARG3.1

Description: Anti-ARC/ARG3.1 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-396 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10082-302
Supplier: Proteintech
Image Unavailable-10349-404

GGT1 Antibody

Description: GGT1 Polyclonal Antibody, Host: Rabbit, Cy5.5 Conjugated, Emmission: 675nm/694nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Elk4; ELK4_HUMAN; ETS domain containing protein Elk4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10349-404
Supplier: Bioss
Product Image-10075-662

GluR1 (phospho Ser845) Antibody

Description: Polyclonal, Host: Rabbit; Species: Human, Mouse, Rat; Immunogen: GluR1 (Ser845) polyclonal antibody was raised against a synthetic phosphopeptide corresponding to amino acids residues surrounding the phospho-Ser845 of rat GluR1; Tested Applications: WB, IF, IHC
Catalog Number: 10075-662
Supplier: Prosci
Product Image-10349-408

GGT1 Antibody

Description: GGT1 Polyclonal Antibody, Host: Rabbit, FITC Conjugated, Emmission: 494nm/518nm, Species: Human, Mouse, Rat, Isotype: IgG, Synonymns: Elk4; ELK4_HUMAN; ETS domain containing protein Elk4, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10349-408
Supplier: Bioss
Image Unavailable-76083-154

GGT1 PAB 100ul

Description: GGT1 Polyclonal Antibody, Host: Rabbit, Species: Human, Mouse, Rat, Isotype: IgG, Conjugate: Alexa Fluor 750, Immunogen: KLH conjugated synthetic peptide derived from GGT1, Synonym: GGT; GTG; CD224; GGT 1; D22S672; D22S732, Glutathione hyd
Catalog Number: 76083-154
Supplier: Bioss
Image Unavailable-103007-212

[Gln22, Asn23] - beta - Amyloid (1 - 40) 0.5 mg

Description: [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-212
Supplier: Anaspec Inc
Product Image-10087-440

Anti-GCLM

Description: Anti-GCLM Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-274 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10087-440
Supplier: Proteintech
Product Image-10090-910

Anti-NPTX2

Description: Anti-NPTX2 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, N-term-350 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10090-910
Supplier: Proteintech
Image Unavailable-CAMB-114-0001

V8 Protease

Description: 1.0mg. Lyophilized. Source: S. aureus strain V8. Specific Activity: 946 units/mg dry weight. Absorbance Data: A280 of 1 mg/ml solution is 0.76. Specifically cleaves peptide bonds on the COOH-terminal side of either aspartic or glutamic acids
Catalog Number: CAMB-114-0001
Supplier: Rockland Immunochemical

SDS


Product Image-10075-660

GluR1 (phospho Ser831) Antibody

Description: Polyclonal, Host: Rabbit; Species Reactivity: Human, Mouse, Rat; Immunogen: GluR1 (Ser831) polyclonal antibody was raised against a synthetic phosphopeptide corresponding to amino acids residues surrounding the phospho-Ser831 of rat GluR1; Tested Applications: WB
Catalog Number: 10075-660
Supplier: Prosci
Product Image-10750-584

HAAO antibody

Description: HAAO antibody, Polyclonal, Host: Rabbit, Species reactivity: Human, Mouse, Rat, Isotype: IgG, Immunogen: HAAO antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human HAAO, Tested applications: ELISA, IF, IHC, WB
Catalog Number: 10750-584
Supplier: Prosci
Image Unavailable-CAAAA10812-09

N ALPHA BENZOYL L ARGININE 99% 10G

Catalog Number: CAAAA10812-09
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAAA10812-18

N ALPHA BENZOYL L ARGININE 99% 50G

Catalog Number: CAAAA10812-18
Supplier: Thermo Scientific Chemicals

Certificates


449 - 464 of 102,268