You Searched For: N-Benzoyl-L-glutamic+acid


102,268  results were found

Sort Results

List View Easy View
SearchResultCount:"102268"
Description: Anti-PROS1 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 328-676 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10092-814
Supplier: Proteintech


Description: Human [Lys22]-beta-Amyloid (1-40)
Catalog Number: 103007-214
Supplier: Anaspec Inc


Description: Calumenin Recombinant Protein, Species: Human, Source: Human Cells, Sequence: Lys20-Phe315, Fusion Tag: C-6 His tag, Purity: Greater than 95% (SDS-PAGE), Physical state: Lyophilized, Synonyms: IEF SSP 9302, CALU, Application: Biological assay, Size: 50 ug
Catalog Number: 75790-154
Supplier: Prosci


Description: Anti-GAD2 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Peptide, Peptide with Sequence CLRTLEDNEERMSRLSKVA, Format:Antigen affinity purification, Application: ELISA, WB, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10087-302
Supplier: Proteintech


Description: Host:Goat Species Reactivity:Rat (Rt) Immunogen:Synthetic peptide sequence (KDAHEKDDFHHLS) corresponding to the internal amino acids of GRIN2B
Catalog Number: CAPIPA5-18536
Supplier: Thermo Scientific


Description: Polyclonal, Host Species: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human GOT1, Tested Application: Elisa, western blotting.
Catalog Number: 10110-048
Supplier: Prosci


Description: [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Molecular Weight: 4442.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-114
Supplier: Anaspec Inc


Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-370
Supplier: Bioss


Description: VKORC1 antibody, Polyclonal, Host: Rabbit, Species reactivity: Human, Mouse, Isotype: IgG, Immunogen: VKORC1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human VKORC1, Tested applications: ELISA, IF, IHC, WB
Catalog Number: 10751-600
Supplier: Prosci


Description: , 7412-78-4, C7H12N2O5, 204.18
Catalog Number: TCG0123-100MG
Supplier: TCI America

Description: CHRNA3 Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: ACHA3_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10447-374
Supplier: Bioss


Description: L-Pyroglutamic Acid, Purity: >97.0%(T), Cas number: 98-79-3, Molecular Formula: C5H7NO3, Molecular Weight: 129.12, Synonyms: L-Glutamic Acid Lactam, H-Pyr-OH, (S)-5-Oxopyrrolidine-2-carboxylic Acid, Appearance: Crystal - Powder, Size: 100G
Catalog Number: TCP0573-100G
Supplier: TCI America

Description: GAD65 (206-220), used to test whether IL-10 interferes with expression of CTLA-4, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): TYEIAPVFVLLEYVT, Molecular weight: 1757.1, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-800
Supplier: Anaspec Inc


Description: Host:Goat Species Reactivity:Mouse (Ms) Rat (Rt) Immunogen:Synthetic peptide sequence (KIRQLPIDSDDSRP) corresponding to the internal amino acids of GRIK3
Catalog Number: CAPIPA5-18964
Supplier: Thermo Scientific


Description: 5G , CAS: 7300-59-6, 7300-59-6, C11H13N3O5, 267.24
Catalog Number: TCG0065-005G
Supplier: TCI America

SDS


Description: 1G , CAS: 7300-59-6, 7300-59-6, C11H13N3O5, 267.24
Catalog Number: TCG0065-001G
Supplier: TCI America

417 - 432 of 102,268