You Searched For: N-Benzoyl-L-glutamic+acid


70,288  results were found

SearchResultCount:"70288"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10167-618)
Supplier: Genetex
Description: Mouse Monoclonal antibody [GT7711] to Glutamine synthetase (glutamate-ammonia ligase)


Catalog Number: (103007-280)
Supplier: Anaspec Inc
Description: GALA is a 30 amino acid synthetic peptide with a glutamic acid-alanine-leucine-alanine (EALA) repeat. It also contains a histidine and tryptophan residue as spectroscopic probes. This peptide was designed to explore how viral fusion protein sequences interact with membranes. It was used to study the importance of the helix length, hydrophobicity, and hydrophobic moment on the formation, structure, and function of ion channels. The membrane-interacting properties of GALA have been extensively documented. Investigations with analogs of cytotoxic peptides clarify the importance of peptide charge and the role of particular amino acids or arrays of amino acids in the conformation, membrane-binding affinity, and pore-forming abilities of these toxins.
Sequence:WEAALAEALAEALAEHLAEALAEALEALAA
MW:3032.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (75811-208)
Supplier: Spectrum Chemicals
Description:  FOLIC ACID, POWDER, USP is a water soluble B vitamin. As a medication, folic acid is used to treat folic acid deficiency associated with ulcerative colitis, alcoholism, kidney dialysis, and liver disease and certain types of anemia. The USP grade indicates it is graded suitable for personal care, cosmetic and pharmaceutical applications. All Spectrum Chemical USP grade products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities. Storage temperature - LIGHT SENSITIVE: Keep tightly closed in light-resistant containers.


Catalog Number: (76077-782)
Supplier: Bioss
Description: This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). Essential for proliferation of fetal skin fibroblasts.


Catalog Number: (103007-216)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (89151-336)
Supplier: Enzo Life Sciences


Catalog Number: (10078-840)
Supplier: Prosci
Description: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.


Catalog Number: (I-1180.0250BA)
Supplier: Bachem Americas
Description: Sequence: H-Glu-AMC


Supplier: Anaspec Inc
Description: This peptide triggers the formation of insoluble Aß peptide deposits, inhibits secretion of amyloid protein precursor (APP) and increases cell-associated APP. The fibrils in the plaques formed in the brains of patients with Alzheimer’s disease contain significant amounts of truncated Aß proteins such as Aß(3-40) and Aß (11- 40). These two fragments contain an N-terminal pyroglutamic acid. The g-carboxy group of glutamic acid forms a cyclic bond with the free N-terminal amino group to form pyroglutamate.

Catalog Number: (10483-752)
Supplier: Bioss
Description: Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamate-gated, cation-specific ion channels. Synaptic and extrasynaptic NMDA receptors have been shown to have opposite effects on neuronal survival, CREB function and gene regulation. Gcom1 (GRINL1A complex locus protein 1), also known as GUP (GRINL1A upstream protein) and Gcom (GRINL1A combined protein), is a 466 amino acid protein that is a component of the GRINL1A complex transcription unit, which is thought to be involved in the modulation of glutamatergic neurotransmission through interaction with the NR1 subunit of the NMDA receptor. Gcom1 is expressed in small intestine, lung, liver, heart, skeletal muscle, testis and prostate and also colocalizes with NR1 in cortical and hippocampal neurons. There are eleven isoforms of Gcom1 that are produced as a result of alternative splicing events.


Catalog Number: (10483-750)
Supplier: Bioss
Description: Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamate-gated, cation-specific ion channels. Synaptic and extrasynaptic NMDA receptors have been shown to have opposite effects on neuronal survival, CREB function and gene regulation. Gcom1 (GRINL1A complex locus protein 1), also known as GUP (GRINL1A upstream protein) and Gcom (GRINL1A combined protein), is a 466 amino acid protein that is a component of the GRINL1A complex transcription unit, which is thought to be involved in the modulation of glutamatergic neurotransmission through interaction with the NR1 subunit of the NMDA receptor. Gcom1 is expressed in small intestine, lung, liver, heart, skeletal muscle, testis and prostate and also colocalizes with NR1 in cortical and hippocampal neurons. There are eleven isoforms of Gcom1 that are produced as a result of alternative splicing events.


Catalog Number: (10483-758)
Supplier: Bioss
Description: Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamate-gated, cation-specific ion channels. Synaptic and extrasynaptic NMDA receptors have been shown to have opposite effects on neuronal survival, CREB function and gene regulation. Gcom1 (GRINL1A complex locus protein 1), also known as GUP (GRINL1A upstream protein) and Gcom (GRINL1A combined protein), is a 466 amino acid protein that is a component of the GRINL1A complex transcription unit, which is thought to be involved in the modulation of glutamatergic neurotransmission through interaction with the NR1 subunit of the NMDA receptor. Gcom1 is expressed in small intestine, lung, liver, heart, skeletal muscle, testis and prostate and also colocalizes with NR1 in cortical and hippocampal neurons. There are eleven isoforms of Gcom1 that are produced as a result of alternative splicing events.


Catalog Number: (76077-784)
Supplier: Bioss
Description: This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity). Essential for proliferation of fetal skin fibroblasts.


Catalog Number: (76108-786)
Supplier: Bioss
Description: Glutamate receptors mediate most excitatory neurotransmission in the brain and play an important role in neural plasticity, neural development and neurodegeneration. Ionotropic glutamate receptors are categorized into NMDA receptors and kainate/AMPA receptors, both of which contain glutamate-gated, cation-specific ion channels. Synaptic and extrasynaptic NMDA receptors have been shown to have opposite effects on neuronal survival, CREB function and gene regulation. Gcom1 (GRINL1A complex locus protein 1), also known as GUP (GRINL1A upstream protein) and Gcom (GRINL1A combined protein), is a 466 amino acid protein that is a component of the GRINL1A complex transcription unit, which is thought to be involved in the modulation of glutamatergic neurotransmission through interaction with the NR1 subunit of the NMDA receptor. Gcom1 is expressed in small intestine, lung, liver, heart, skeletal muscle, testis and prostate and also colocalizes with NR1 in cortical and hippocampal neurons. There are eleven isoforms of Gcom1 that are produced as a result of alternative splicing events.


Catalog Number: (10485-890)
Supplier: Bioss
Description: The function of RED is currently unknown. The protein encoded by the RED gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. This gene maps to chromosome 5; however, a pseudogene may exist on chromosome 2.


Catalog Number: (10485-886)
Supplier: Bioss
Description: The function of RED is currently unknown. The protein encoded by the RED gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. This gene maps to chromosome 5; however, a pseudogene may exist on chromosome 2.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
225 - 240 of 70,288
no targeter for Bottom