Print…

You Searched For: Molecular+sieve+A5+(0.5+nm,+5+\u00C5)


132,953  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"132953"

Rate These Search Results

Image Unavailable-102996-262

PACAP (1-38) 0.5 mg

Description: PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4534.3, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Lyophilized white powder, isolated from bovine hypothalmus, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-262
Supplier: Anaspec Inc
Image Unavailable-75981-340

Laminin MAB 100uL

Description: Laminin, Monoclonal antibody, Clone: A5, Host: Rat, Species reactivity: Mouse, Human, Isotype: IgG2a, kappa, Conjugate: CF640R, Immunogen: Murine EHS laminin preparation, Synonyms: LAMB2; LAMC1; Laminin B2 chain, Application: Immunofluorescence, Flow cytometry, Size: 100uL
Catalog Number: 75981-340
Supplier: Biotium
Image Unavailable-75981-342

Laminin MAB 500uL

Description: Laminin, Monoclonal antibody, Clone: A5, Host: Rat, Species reactivity: Mouse, Human, Isotype: IgG2a, kappa, Conjugate: CF640R, Immunogen: Murine EHS laminin preparation, Synonyms: LAMB2; LAMC1; Laminin B2 chain, Application: Immunofluorescence, Flow cytometry, Size: 500uL
Catalog Number: 75981-342
Supplier: Biotium
Image Unavailable-102996-412

PACAP (1-38)-Lys(Biotin) 0.5 mg

Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-412
Supplier: Anaspec Inc
Image Unavailable-32574-826

Refill Kit

Description: For use with LabClear* Refillable Inline Gas Filter. Contains mixture of indicating DRIERITE* dessicant and 13x molecular sieve.
Catalog Number: 32574-826
Supplier: Labclear
Image Unavailable-55009-276

Synthetic Zeolite Element for Molecular Traps

Description: For molecular traps 55009-272, -274.
Catalog Number: 55009-276
Supplier: Welch Vacuum
Image Unavailable-75981-322

Laminin MAB 500uL

Description: Laminin, Monoclonal antibody, Clone: A5, Host: Rat, Species reactivity: Mouse, Human, Isotype: IgG2a, kappa, Conjugate: CF488A, Immunogen: Murine EHS laminin preparation, Synonyms: LAMB2; LAMC1; Laminin B2 chain, Application: Immunofluorescence, Flow cytometry, Size: 500uL
Catalog Number: 75981-322
Supplier: Biotium
Image Unavailable-75981-320

Laminin MAB 100uL

Description: Laminin, Monoclonal antibody, Clone: A5, Host: Rat, Species reactivity: Mouse, Human, Isotype: IgG2a, kappa, Conjugate: CF488A, Immunogen: Murine EHS laminin preparation, Synonyms: LAMB2; LAMC1; Laminin B2 chain, Application: Immunofluorescence, Flow cytometry, Size: 100uL
Catalog Number: 75981-320
Supplier: Biotium
Product Image-32940-057

Drying train for ca glove box

Description: 115v 60 Hz. Drying train provides a means for reducing the humidity within the glove box to less than 5 ppm. includes one molecular sieve column, 1 cf. pump and stainless steel tubing to connect column to pump. Glove box accessory.
Catalog Number: 32940-057
Supplier: Labconco
Product Image-10851-204

MXT* Msieve 5A Column 50um

Description: MXT* Msieve 5A Column (Siltek* treated stainless steel PLOT), Length: 30m, ID: 0.53mm, df: 50um, Config: 3.5 inch,Temperature: 200 deg C, Equivalent to USP G43 phase, Rugged material, Designed for robust performance in process GCs and field instrument, capillary column
Catalog Number: 10851-204
Supplier: Restek
Product Image-10851-118

MXT* Msieve 5A Column 50um

Description: MXT* Msieve 5A Column (Siltek* treated stainless steel PLOT), Length: 30m, ID: 0.53mm, df: 50um, Config: 7 inch 11-pin cage,Temperature: 200 deg C, Equivalent to USP G43 phase, Rugged material, Designed for robust performance in process GCs and field instrument
Catalog Number: 10851-118
Supplier: Restek
Product Image-CA5060-9084

Moisture trap, conditioned molecular sieve, S-shaped, 0.1 ppm

Description: Moisture trap, conditioned molecular sieve, S-shaped, 0.1 ppm
Catalog Number: CA5060-9084
Supplier: AGILENT TECHNOLOGIES, INC (CSD) CA
Product Image-RC6087-1

POT. DICHROMATE 0.5 AU @ 280NM

Catalog Number: RC6087-1
Supplier: Ricca Chemical

SDS Certificates Small Business Enterprise


Image Unavailable-75981-318

Laminin MAB 500uL

Description: Laminin, Monoclonal antibody, Clone: A5, Host: Rat, Species reactivity: Mouse, Human, Isotype: IgG2a, kappa, Conjugate: CF405S, Immunogen: Murine EHS laminin preparation, Synonyms: LAMB2; LAMC1; Laminin B2 chain, Application: Immunofluorescence, Flow cytometry, Size: 500uL
Catalog Number: 75981-318
Supplier: Biotium
Image Unavailable-75981-316

Laminin MAB 100uL

Description: Laminin, Monoclonal antibody, Clone: A5, Host: Rat, Species reactivity: Mouse, Human, Isotype: IgG2a, kappa, Conjugate: CF405S, Immunogen: Murine EHS laminin preparation, Synonyms: LAMB2; LAMC1; Laminin B2 chain, Application: Immunofluorescence, Flow cytometry, Size: 100uL
Catalog Number: 75981-316
Supplier: Biotium
Product Image-10058-534

Column

Description: Column, RT*-MSIEVE 5A, fused silica PLOT, Length: 30 m, Internal Diameter: 0.32mm, DF: 30um, Temperature Limits: to 300 DegreeC
Catalog Number: 10058-534
Supplier: Restek
129 - 144 of 132,953