You Searched For: Molecular+sieve+A5+(0.5+nm,+5+\u00C5)


131,010  results were found

Sort Results

List View Easy View
SearchResultCount:"131010"
Description: Anti-LAMC1 Rat Monoclonal Antibody (CF594) [clone: A5]
Catalog Number: 75981-338
Supplier: Biotium


Description: Anti-LAMC1 Rat Monoclonal Antibody (CF647) [clone: A5]
Catalog Number: 75981-344
Supplier: Biotium


Description: Anti-LAMC1 Rat Monoclonal Antibody (CF647) [clone: A5]
Catalog Number: 75981-044
Supplier: Biotium


Description: Biotin-PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4761.6, Sequence: Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-382
Supplier: Anaspec Inc


Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-412
Supplier: Anaspec Inc


Description: Anti-LAMC1 Rat Monoclonal Antibody (CF405S) [clone: A5]
Catalog Number: 75981-318
Supplier: Biotium


Description: Anti-LAMC1 Rat Monoclonal Antibody (CF405S) [clone: A5]
Catalog Number: 75981-316
Supplier: Biotium


Description: Annexin A5 Recombinant Protein, Species: Human, Source Species: E. Coli, Fusion Tag: Tag free, Purity: >98% as determined by SDS-PAGE, Physical state: Lyopholized, Synonym: ANXA5, ANX5, ENX2, PP4, Annexin V, Annexin A5, Application: WB, Size: 100UG
Catalog Number: 10796-992
Supplier: Prosci


Description: 25mg The sequence of this opioid peptide was found at 15 sites in the primary structure of the high molecular weight glutenin. Gluten exorphin A5 is highly specific for d-receptors and displays opioid activity in the MVD assay. The N-terminal Gly increases its activity - thus the structure-activity relationships of gluten exorphins A are quite different from those of the endogenous opioid peptides. CAS: 142155-24-6 C29H37N5O9 FW: 599.64 . gluten
Catalog Number: H-1668.0025BA
Supplier: Bachem Americas


Description: Human Recombinant Annexin A51 (from <i>E. coli</i>)
Catalog Number: 10796-994
Supplier: Prosci


Description: UV/Visible spectrophotometer, VWR®, Tungsten/deuterium, Single beam, grating 1200 lines/mm silicon photodiode detector, Photometric range: −0.3 to 3 A; 0 - 200% T, Photometric accuracy: ±0.5% T , Wavelength accuracy: ±0,5 nm, 490 × 360 × 240 mm
Catalog Number: 10037-436
Supplier: VWR International

Description: UV/Visible spectrophotometer, VWR®, P4, Tungsten / deuterium, Absorbance range: –0.3...+3.0 A, Photometric range: 0 - 200% T, Wavelength accuracy: ±0.5 nm, 456×360×185 mm, 10.7 kg
Catalog Number: 76520-712
Supplier: VWR International


Description: UV/Visible spectrophotometer, VWR®, Tungsten/deuterium, Single beam, grating 1200 lines/mm, silicon photodiode detector, Photometric range: −0.3 to 3 A; 0 - 200% T; 0 - 9999 Conc, Photometric accuracy: ≤±0.5% T or 0.005 A at 1 A, Wavelength accuracy: ±0,5 nm
Catalog Number: 10037-438
Supplier: VWR International

Description: UV/Visible spectrophotometer, VWR®, Tungsten, Single beam, grating 1200 lines/mm silicon photodiode detector, Photometric range: −0.3 to 3 A; 0 - 200% T, Photometric accuracy: ±0.5% T , Wavelength accuracy: ±2 nm, 490 × 360 × 240 mm
Catalog Number: 10037-434
Supplier: VWR International

Description: UV/Visible spectrophotometer, VWR®, PV4, Tungsten lamp, Single beam, Photometric range: –0.301...+3 A; 0 - 200% T; 0 – 9999.9 conc, Wavelength accuracy: ±0.5 nm, 456×360×185 mm, 10.5 kg
Catalog Number: 76520-714
Supplier: VWR International


Catalog Number: 76777-150
Supplier: VWR International


81 - 96 of 131,010