Print…

You Searched For: 2-Phenoxybenzyl+bromide


34,963  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"34963"

Rate These Search Results

Image Unavailable-77674-736

Foalwatch (Calcium) Test Kit, CHEMetrics

Description: The FoalWatch system is based on proven chemistry, so you can rest easier at night. The test measures the concentration of calcium in the, colostrum. The calcium level rises sharply before birth. Simply begin testing once or twice a day about 2 weeks before the mareís expected foaling date. When the calcium concentration consistently exceeds 200 parts per million (ppm), birth is imminent.FoalWatch Kit contains everything you need for testing.
Catalog Number: 77674-736
Supplier: CHEMetrics

New Product


Image Unavailable-10390-184

Anti-CACNA1A Rabbit Polyclonal Antibody (Cy3®)

Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.
Catalog Number: 10390-184
Supplier: Bioss
Image Unavailable-10390-172

Anti-CACNA1A Rabbit Polyclonal Antibody

Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.
Catalog Number: 10390-172
Supplier: Bioss
Image Unavailable-10018-202

Rhod-590 tripotassium salt fluorescent indicator, for calcium determination

Description: Membrane-impermeant calcium indicator that can be loaded into cells via microinjection or scrape loading.
Catalog Number: 10018-202
Supplier: Biotium
Product Image-76701-008

Human S100 Calcium Binding Protein A6, Calgranulin A (S100A6) ELISA Kit

Description: Human S100 Calcium Binding Protein A6, Calgranulin A (S100A6) ELISA Kit
Catalog Number: 76701-008
Supplier: AFG Bioscience
Product Image-76707-134

Rat Calcium/Calmodulin-dependent Protein Kinase-II (CAMK 2) ELISA Kit

Description: Rat Calcium/Calmodulin-dependent Protein Kinase-II (CAMK 2) ELISA Kit
Catalog Number: 76707-134
Supplier: AFG Bioscience
Product Image-76714-556

Human Calcium Binding Mitochondrial Carrier Protein Aralar1 (SLC25A12) ELISA Kit

Description: Human Calcium Binding Mitochondrial Carrier Protein Aralar1 (SLC25A12) ELISA Kit
Catalog Number: 76714-556
Supplier: AFG Bioscience
Image Unavailable-77986-250

TRC 2-Hydroxy Atorvastatin Calcium Salt

Description: TRC 2-Hydroxy Atorvastatin Calcium Salt
Catalog Number: 77986-250
Supplier: LGC Standards

New Product


Product Image-76715-604

Human Calcium/Calmodulin-Dependent Protein Kinase-2 (CAMK 2) ELISA Kit

Description: Human Calcium/Calmodulin-Dependent Protein Kinase-2 (CAMK 2) ELISA Kit
Catalog Number: 76715-604
Supplier: AFG Bioscience
Image Unavailable-77987-959

TRC Leucovorin-d4 Calcium Salt Hydrate, > 90%

Description: TRC Leucovorin-d4 Calcium Salt Hydrate, > 90%
Catalog Number: 77987-959
Supplier: LGC Standards

New Product


Product Image-76711-978

Human Calcium/Calmodulin-Dependent Protein Kinase type II Subunit beta (CAMK2B) ELISA Kit

Description: Human Calcium/Calmodulin-Dependent Protein Kinase type II Subunit beta (CAMK2B) ELISA Kit
Catalog Number: 76711-978
Supplier: AFG Bioscience
Image Unavailable-103008-282

Ryanodine receptor 1 Peptide

Description: This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-282
Supplier: Anaspec Inc
Image Unavailable-10390-186

Anti-CACNA1A Rabbit Polyclonal Antibody (Cy5®)

Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.
Catalog Number: 10390-186
Supplier: Bioss
Image Unavailable-10390-188

Anti-CACNA1A Rabbit Polyclonal Antibody (Cy5.5®)

Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.
Catalog Number: 10390-188
Supplier: Bioss
Image Unavailable-10486-198

Anti-CASR Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Description: Senses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Catalog Number: 10486-198
Supplier: Bioss
Product Image-10099-794

Anti-SLC8B1 Rabbit Polyclonal Antibody

Description: SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).
Catalog Number: 10099-794
Supplier: Prosci
1,121 - 1,136 of 34,963