Print…

You Searched For: Methenamine


16,821  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"16821"

Rate These Search Results

Image Unavailable-Q-2665.0500BA

6-Carboxyfluorescein

Description: Sequence: 6-Carboxy-fluorescein
Synonym(s): 6-FAM#2-(6-Hydroxy-3-oxo-3H-xanthen-9-yl)-terephthalic acid
Catalog Number: Q-2665.0500BA
Supplier: Bachem Americas
Image Unavailable-103006-064

Human Beta-Amyloid (1-42), FAM (Carboxyfluorescein)

Description: This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103006-064
Supplier: Anaspec Inc
Image Unavailable-103009-020

Cyclo[-RGDy-K(5-FAM)], FAM (Carboxyfluorescein)

Description: This peptide is a 5-FAM-labeled cylic RGDyK peptide. RGD peptides serve as ligands for av-integrin and inhibit angiogenesis, induce endothelial apoptosis, decrease tumor growth, and reduce spread of metastasis.
Sequence:Cyclo[-RGDy-K(5-FAM)]
MW:978 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103009-020
Supplier: Anaspec Inc
Product Image-75784-794

Prolex™ Staph Latex Test Reagent Kit, Pro-Lab Diagnostics

Description: The Prolex™ Staph Latex Kit provides a rapid platform for the identification of Staphylococcal isolates particularly Staphylococcus aureus which possess bound coagulase (clumping factor) and/or protein A from other species of staphylococci
Catalog Number: 75784-794
Supplier: PRO-LAB DIAGNOSTICS INC CA
Image Unavailable-103005-918

Gila Exendin 4, FAM-labeled, FAM (Carboxyfluorescein)

Description: This full length Exendin 4 amide peptide is labeled with a fluorescent dye (FAM), Abs/Em = 494/519 nm, on its N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4545 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103005-918
Supplier: Anaspec Inc
Image Unavailable-103003-074

Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)

Description: This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103003-074
Supplier: Anaspec Inc
Image Unavailable-103006-122

Human BAD (103-127), FAM (Carboxyfluorescein)

Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-122
Supplier: Anaspec Inc
Image Unavailable-102996-804

Human Endothelin 1, FAM (Carboxyfluorescein)

Description: This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 102996-804
Supplier: Anaspec Inc
Image Unavailable-103010-760

6-Carboxyfluorescein

Description: 6-FAM is another isomer of carboxyfluorescein. It is mainly used in sequencing of nucleic acids and labeling nucleotides.
Catalog Number: 103010-760
Supplier: Anaspec Inc
Image Unavailable-103003-194

Glycogen synthase 1-10, FAM (Carboxyfluorescein)

Description: The native peptide, PLSRTLSVSS-NH2 (cat# 60514-1), is a synthetic substrate for Ca2+-calmodulin-dependent protein kinase II (Km = 7.5 µM). Maximal activation of the decapeptide substrate phosphorylation requires the presence of Ca2+ and calmodulin and is dependent on Ca2+ concentration.
Sequence:5-FAM-PLSRTLSVSS-NH2
MW:1403.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103003-194
Supplier: Anaspec Inc
Image Unavailable-103006-970

Histone H1-derived Peptide, FAM (Carboxyfluorescein)

Description: This is a FAM-labeled Histone H1-derived peptide (Ab/Em = 494/521 nm). Histone H1-derived peptide phosphorylated by protein kinase A, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.
Sequence:5-FAM-GGGPATPKKAKKL
MW:1610.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103006-970
Supplier: Anaspec Inc
Image Unavailable-103007-782

HIV gp91 TAT FAM, FAM (Carboxyfluorescein)

Description: This FAM labeled peptide (Abs/Em=492/518 nm) is composed of gp91phox sequence linked to the human immunodeficiency virus (HIV)-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2
MW: 3031.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-782
Supplier: Anaspec Inc
Image Unavailable-103007-566

Human Beta-Amyloid (11-40), FAM (Carboxyfluorescein)

Description: This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-566
Supplier: Anaspec Inc
Image Unavailable-103010-746

5(6)-Carboxyfluorescein

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.
Catalog Number: 103010-746
Supplier: Anaspec Inc
Product Image-75817-070

Oxygen Consumption Rate Assay Kit, Cayman Chemical

Description: For the measurement of oxygen consumption rate in living cells
Catalog Number: 75817-070
Supplier: Cayman Chemical Company
Product Image-77216-128

Anti-FITC / 5-FAM / 6-FAM Rabbit Monoclonal Antibody [clone: ARC51073]

Description: Rabbit monoclonal [ARC51073] antibody to FITC / 5-FAM / 6-FAM for WB and ELISA with samples derived from Species Independent.
Catalog Number: 77216-128
Supplier: ANTIBODIES.COM LLC
49 - 64 of 16,821