Print…

You Searched For: Ionomycin+calcium+salt


16,667  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"16667"

Rate These Search Results

Image Unavailable-10428-896

CADM3 Antibody

Description: CADM3 Polyclonal Antibody, Host: Rabbit , Cy3 Conjugated, Emmission: 512,550nm/570,615nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TSLL1; CADM3_HUMAN., Application: IF(IHC-P), 100ul
Catalog Number: 10428-896
Supplier: Bioss
Image Unavailable-10428-898

CADM3 Antibody

Description: CADM3 Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TSLL1; CADM3_HUMAN., Application: IF(IHC-P), 100ul
Catalog Number: 10428-898
Supplier: Bioss
Product Image-10428-884

CADM3 Antibody

Description: CADM3 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TSLL1; CADM3_HUMAN., Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10428-884
Supplier: Bioss
Image Unavailable-10428-904

CADM3 Antibody

Description: CADM3 Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: TSLL1; CADM3_HUMAN., Application: IF(IHC-P), 100ul
Catalog Number: 10428-904
Supplier: Bioss
Image Unavailable-77180-820

ANTIBODY A316953-100

Catalog Number: 77180-820
Supplier: ANTIBODIES.COM LLC
Product Image-10751-864

TPT1 antibody

Description: TPT1 antibody, Polyclonal, Host: Rabbit, Species reactivity: Human, Isotype: IgG, Immunogen: Rabbit polyclonal TPT1 antibody was raised against a 19 amino acid peptide near the center of human TPT1, Tested applications: ELISA, IF, IHC, WB
Catalog Number: 10751-864
Supplier: Prosci
Image Unavailable-10464-160

SERCA1 ATPase Antibody

Description: SERCA1 ATPase Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: AT2A1_HUMAN; ATP2A; ATP2A1, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10464-160
Supplier: Bioss
Image Unavailable-10396-940

BNIP3 Antibody

Description: BNIP3 Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: BCL2 Adenovirus E1B 19kDa Interacting Protein 3, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10396-940
Supplier: Bioss
Image Unavailable-103011-166

Indo-1 AM calcium sensor dye

Description: Indo-1 AM calcium sensor dye
Catalog Number: 103011-166
Supplier: Anaspec Inc
Product Image-10110-790

CPNE4 Antibody

Description: Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, rat, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human CPNE4, purified by peptide affinity chromatography method, Application: ELISA, western blot.
Catalog Number: 10110-790
Supplier: Prosci
Image Unavailable-102996-094

Parathyroid Hormone (1-34) 1 mg

Description: Parathyroid Hormone (1-34), human, Purity: HPLC >/= to 95%, Molecular Weight: 4117.8, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVF, Appearance: Lyophilized white powder, regulates the metabolism of calcium and phosphate, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-094
Supplier: Anaspec Inc
Product Image-77521-242

ELISA KIT CATTLE SANDWICH EK245413

Catalog Number: 77521-242
Supplier: AFG Bioscience
Product Image-CAJT2841-5

1-Pentanesulfonic Acid, Sodium Salt

Description: n-Amylsulfonic acid, sodium salt; Sodium pentanesulfonate. CAS RN 22767-49-3. Formula Weight: 174.21. Crystals, HPLC grade, 98.0% min. For ion-pair chromatography of basic compounds. UV cut-off 210nm. 25g.
Catalog Number: CAJT2841-5
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

Certificates


Image Unavailable-89319-850

Rabbit Polyclonal antibody to CaMKI gamma (calcium/calmodulin-dependent protein kinase IG)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89319-850
Supplier: Genetex
Product Image-77050-536

ANTIBODY A95497-100

Catalog Number: 77050-536
Supplier: ANTIBODIES.COM LLC
Product Image-10106-536

TRPM3 Antibody

Description: Polyclonal, Host:Rabbit, Species reactivity:Human, Immunogen:Produced in rabbits immunized with a synthetic peptide corresponding a region of human TRPM3, purified by protein A chromatography method, Application:Elisa
Catalog Number: 10106-536
Supplier: Prosci
1,313 - 1,328 of 16,667