Print…

You Searched For: Tetraethylene+glycol


66,383  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"66383"

Rate These Search Results

Image Unavailable-TCM2580-1G

6-(Methoxycarbonyl)picolinic acid ≥97.0% (by GC, titration analysis)

Description: CAS Number: 7170-36-7
MDL Number: MFCD00806109
Molecular Formula: C8H7NO4
Molecular Weight: 181.15
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 153
Catalog Number: TCM2580-1G
Supplier: TCI America

SDS


Product Image-CA95046-446

Anti-GS28 Mouse Monoclonal Antibody

Description: Golgi SNARE of 28 kDa (GS28), also known as p28 or GOS28, is a 28 kDa integral membrane protein on the surface of the Golgi apparatus that serves as a t-SNARE in ER to Golgi transport. The amino-terminal of GS28 is exposed to the cytosol and is anchored to the cis Golgi via a 20 amino acid carboxyl-terminal hydrophobic tail. GS28 co-immunoprecipitates complexes consisting of Syntaxin 5, Rbet1, Membrin, Rsec22, and Rsly1, and is therefore implicated in ER to-Golgi or intra-Golgi vesicle transport.
Catalog Number: CA95046-446
Supplier: Enzo Life Sciences
Image Unavailable-10093-960

Anti-RPS27A Rabbit Polyclonal Antibody

Description: RPS27A, also named as UBA80 and UBCEP1, can be cleaved into two chains Ubiquitin and 40S ribosomal protein S27a. Ubiquitin is a highly conserved 76-amino acid protein that plays a key role in protein degradation. Ubiquitin is synthesized as precursor proteins that consist either of polyubiquitin chains that are cleaved into moieties of the UBB or UBC types, or single ubiquitin moieties fused 5-prime to unrelated carboxyl extension proteins (UBA type) such as UBA52 and UBA80 (RPS27A)
Catalog Number: 10093-960
Supplier: Proteintech
Image Unavailable-10423-848

Anti-PRODH Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Catalog Number: 10423-848
Supplier: Bioss
Image Unavailable-TCT1822-001G

1-(Triisopropylsilyl)indole ≥94.0%

Description: CAS Number: 123191-00-4
MDL Number: MFCD02093498
Molecular Formula: C17H27NSi
Molecular Weight: 273.50
Purity/Analysis Method: >94.0% (GC)
Form: Clear Liquid
Color: Yellow
Specific Gravity (20/20): 0.99
Catalog Number: TCT1822-001G
Supplier: TCI America

SDS


Product Image-76333-144

Empore™ Solid Phase Extraction Disks, CDS Analytical

Description: Empore SPE disks are a cost-effective and trusted solution in large-volume sample processing for more than 30 years.
Catalog Number: 76333-144
Supplier: CDS ANALYTICAL
Product Image-CA71002-936

HOOK™ Carboxyl Reactive Biotin Reagents & Kits for Highly Efficient Protein Labeling, G-Biosciences

Description: The use of biotin for non-radioactive labeling of proteins and nucleic acids has now become an increasingly popular technique in life science research
Catalog Number: CA71002-936
Supplier: G-Biosciences

SDS


Image Unavailable-TCP2578-1G

5-Phenyl-5H-pyrido[3,2-b]indole ≥98.0% (by GC)

Description: 5-Phenyl-5H-pyrido[3,2-b]indole, Purity: >98.0%(GC), CAS Number: 1541200-53-6, Molecular Formula: C17H12N2, Molecular Weight: 244.30, Synonyms: 9-Phenyl- delta -carboline, Size: 200MG
Catalog Number: TCP2578-1G
Supplier: TCI America
Image Unavailable-CAAAB21672-18

N-Carbobenzoxy-L-proline ≥98%

Description: N-Carbobenzoxy-L-proline ≥98%
Catalog Number: CAAAB21672-18
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-TCE1068-1G

Ethyl-4,6-dichloronicotinate ≥98.0% (by GC)

Description: CAS Number: 40296-46-6
MDL Number: MFCD00173839
Molecular Formula: C8H7Cl2NO2
Molecular Weight: 220.05
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 85
Melting point (°C): 33
Catalog Number: TCE1068-1G
Supplier: TCI America

SDS Certificates


Image Unavailable-103009-746

Tau Peptide (337-368) (Repeat 4 Domain)

Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103009-746
Supplier: Anaspec Inc
Image Unavailable-TCT0177-100G

Thiophene-2-carbonyl chloride ≥99.0% (by titrimetric analysis)

Description: CAS Number: 5271-67-0
MDL Number: MFCD00005428
Molecular Formula: C5H3ClOS
Molecular Weight: 146.59
Purity/Analysis Method: >99.0% (T)
Form: Clear Liquid
Color: Very Pale Yellow
Boiling point (°C): 190
Flash Point (°C): 90
Specific Gravity (20/20): 1.38
Catalog Number: TCT0177-100G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCP2322-200MG

3-(Piperidin-4-yl)-1H-indole ≥98.0% (by GC, titration analysis)

Description: 3-(4-Piperidyl)indole, Purity: >98.0%(GC)(T), Cas number: 17403-09-7, Molecular Formula: C13H16N2, Molecular Weight: 200.29, Synonyms: 4-(3-Indolyl)piperidine, Appearance: Very pale yellow - Pale yellow solid crystal powder, Size: 1G
Catalog Number: TCP2322-200MG
Supplier: TCI America

SDS


Image Unavailable-CAAAAL02212-06

1-Methyl-1H-indole-3-carbaldehyde ≥98%

Description: 1-Methyl-1H-indole-3-carbaldehyde ≥98%
Catalog Number: CAAAAL02212-06
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-TCB3539-1G

(1S,3R)-3-(tert-Butoxycarbonylamino)cyclohexanecarboxylic acid ≥97.0% (by GC, titration analysis)

Description: CAS Number: 222530-34-9
MDL Number: MFCD06227743
Molecular Formula: C12H21NO4
Molecular Weight: 243.30
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Specific rotation [a]20/D: 50 deg (C=1, MeOH)
Catalog Number: TCB3539-1G
Supplier: TCI America

SDS


Image Unavailable-89359-522

Anti-RPS6 Rabbit Polyclonal Antibody

Description: 40S ribosomal protein S6 (also known as RPS6) is a ~31 kDa substrate of p70 S6 kinase (p70S6K) and a major component of translational machinery involved in protein synthesis, cell growth, proliferation, and metabolism. RPS6 undergoes phosphorylation on multiple serines in the carboxyl terminal region in the order 236-->235-->240-->244-->247, due to the positions of these amino acid residues on the alpha-helix. Hyperphosphorylation of RPS6 stimulates protein synthesis that mediates progression through the cell cycle.
Catalog Number: 89359-522
Supplier: Genetex
497 - 512 of 66,383