Print…

You Searched For: 3,4-Diaminoanisole


65,279  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"65279"

Rate These Search Results

Image Unavailable-H-4835.0001BA

PTH (1-34) (HUMAN)

Description: 1mg This peptide consisting of the N-terminal 34 amino acid residues of pTH shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD). CAS: 52232-67-4 C181H291N55O51S2 FW: 4117.77 . Synonym: Teriparatide
Catalog Number: H-4835.0001BA
Supplier: Bachem Americas
Image Unavailable-H-4835.0005BA

PTH (1-34) (HUMAN)

Description: 5mg This peptide consisting of the N-terminal 34 amino acid residues of pTH shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD). CAS: 52232-67-4 C181H291N55O51S2 FW: 4117.77 . Synonym: Teriparatide
Catalog Number: H-4835.0005BA
Supplier: Bachem Americas
Product Image-ABCA_AB224734-50UG

ANTIBODY IL-34 AB224734-50UG

Catalog Number: ABCA_AB224734-50UG
Supplier: Abcam

New Product


Image Unavailable-H-3092.0500BA

(TYR1)-PTH (1-34) (HUMAN)

Description: 0.5mg C189H295N55O51S2 FW: 4193.87 . Synonym: (Tyr1)-Parathyroid (1-34) (human)
Catalog Number: H-3092.0500BA
Supplier: Bachem Americas
Image Unavailable-H-9110.0500BA

(NLE8·18,TYR34)-PTH (1-34) (HUMAN) 0.5mg CAS: 78041-34-6 C183H295N55O52 FW: 4097.69. pTH

Description: (NLE8·18,TYR34)-PTH (1-34) (HUMAN) 0.5mg CAS: 78041-34-6 C183H295N55O52 FW: 4097.69. pTH
Catalog Number: H-9110.0500BA
Supplier: Bachem Americas
Image Unavailable-H-9110.1000BA

(NLE8·18,TYR34)-PTH (1-34) (HUMAN) 1mg CAS: 78041-34-6 C183H295N55O52 FW: 4097.69. pTH

Description: (NLE8·18,TYR34)-PTH (1-34) (HUMAN) 1mg CAS: 78041-34-6 C183H295N55O52 FW: 4097.69. pTH
Catalog Number: H-9110.1000BA
Supplier: Bachem Americas
Image Unavailable-103888-888

Human IL-34 Protein, His Tag, Source: expressed from human 293 cells (HEK293). It contains AA Asn 21 - Pro 242, Predicted N-terminus: Asn 21, protein carries a polyhistidine tag at the C-terminus, Synonyms: IL34, C16orf77, IL-34, Interleukin-34, MGC34647, Size: 100uG

Description: Human IL-34 Protein, His Tag, Source: expressed from human 293 cells (HEK293). It contains AA Asn 21 - Pro 242, Predicted N-terminus: Asn 21, protein carries a polyhistidine tag at the C-terminus, Synonyms: IL34, C16orf77, IL-34, Interleukin-34, MGC34647, Size: 100uG
Catalog Number: 103888-888
Supplier: ACROBIOSYSTEMS INC MS
Product Image-CA103258-574

B1-3,4 Galactosidase 400 units

Description: B1-3,4 Galactosidase, Source: Cloned from bovine testis and expressed in Pichia pastoris, Concentration: 8000 units/ml, Molecular weight: 71 kDa, Application: Glycoprotein Production in Various Expression Systems, Sequencing Glycans, Storage: 4 deg C, Size: 400units
Catalog Number: CA103258-574
Supplier: New England Biolabs (NEB)
Image Unavailable-TCC2832-1G

(s)-6-chloro-4-hydroxy-3, 4-dihydro-2h-thieno[3, 2-e][1, 2]thiazine 1, 1-dioxide

Description: (s)-6-chloro-4-hydroxy-3, 4-dihydro-2h-thieno[3, 2-e][1, 2]thiazine 1, 1-dioxide, Purity: >98.0% by HPLC/Titration, CAS Number: 160982-16-1, Molecular Formula: C6H6ClNO3S2, Molecular Weight: 239.69, Size: 1G, 160982-16-1, C6H6ClNO3S2, 239.69
Catalog Number: TCC2832-1G
Supplier: TCI America

SDS


Image Unavailable-TCC2832-5G

(s)-6-chloro-4-hydroxy-3, 4-dihydro-2h-thieno[3, 2-e][1, 2]thiazine 1, 1-dioxide

Description: (s)-6-chloro-4-hydroxy-3, 4-dihydro-2h-thieno[3, 2-e][1, 2]thiazine 1, 1-dioxide, Purity: >98.0% by HPLC/Titration, CAS Number: 160982-16-1, Molecular Formula: C6H6ClNO3S2, Molecular Weight: 239.69, Size: 5G, 160982-16-1, C6H6ClNO3S2, 239.69
Catalog Number: TCC2832-5G
Supplier: TCI America

SDS


Product Image-CA439107-BL

MU IL-34 PRECOATED ELISA KIT 1 PLT

Description: LEGEND MAX* Mouse IL-34 ELISA Kit with Pre-coated Plates; Reactivity: Mouse; Apps: ELISA
Catalog Number: CA439107-BL
Supplier: Biolegend
Product Image-76703-158

ELISA KIT RAT INTERLEUKIN-34 EK720296

Catalog Number: 76703-158
Supplier: AFG Bioscience
Image Unavailable-103319-036

Anti-IL-7RA Mouse Monoclonal Antibody [clone: R34-34]

Description: Anti-IL-7RA Mouse Monoclonal Antibody [clone: R34-34]
Catalog Number: 103319-036
Supplier: Novus Biologicals
Image Unavailable-103009-498

[Lys(Ac)27]-Histone H3 (23-34), H3K27(Ac)

Description: [Lys(Ac)27]-Histone H3 (23-34), H3K27(Ac), Purity: HPLC >/= 95%, MW: 1156.3, Sequence: [KAAR-K(Ac)-SAPATGG] This is histone H3 (23-34) with acetylation at Lys27. Associated with histone deposition in replicating chromatin. Store: -20 deg C, Size: 1mg
Catalog Number: 103009-498
Supplier: Anaspec Inc
Image Unavailable-102996-410

Parathyroid Hormone (1-34)-Lys(Biotin) 1 mg

Description: Parathyroid Hormone (1-34)-Lys(Biotin), human, Purity: HPLC >/= 95%, Molecular Weight: 4472.2, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-410
Supplier: Anaspec Inc
Product Image-ABCA_AB213873-1X96

ELISA KIT MOUSE IL-34 AB213873-1X96TESTS

Catalog Number: ABCA_AB213873-1X96
Supplier: Abcam

New Product


705 - 720 of 65,279