Print…

You Searched For: H-Lys(Me)\u2082-OH+\u00B7+HCl


12,682  results were found

Refine Results Sort by
SearchResultCount:"12682"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CABJPP230-204

Methanol ≥99.9%, Purified Plus® ACS for organic synthesis, for preparative liquid chromatography, Burdick & Jackson™

Supplier: Burdick & Jackson
Description: Clear liquid. For specialty organic synthesis, preparative scale liquid chromatography, glassware cleaning, and applications requiring ACS reagent-grade solvent. The 54gal. drum is individually analyzed with certificate on label.

SDS Certificates

Image Unavailable-103009-174

[Lys(Ac)14/18/23]-Histone H3 (1-24)-GGK,Biotin

Catalog Number: (103009-174)
Supplier: Anaspec
Description: This peptide is histone H3 (1-24) acetylated at Lys14, Lys18, and Lys23, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-A-GGK(Biotin)
MW:3149.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-996

[pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: (103007-996)
Supplier: Anaspec
Description: This peptide is Histone H3 amino acid residues 1 to 21 phosphorylated at Ser-10 and acetylated at Lys-14 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGG-K(Ac)-APRKQLA-GGK(Biotin)
MW:2845.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-89156-514

FLUOR DE LYS® HDAC8 Fluorometric Drug Discovery Kit, Enzo Life Sciences

Catalog Number: (89156-514)
Supplier: Enzo Life Sciences
Description: A Fluor de Lys® fluorescent assay system
Image Unavailable-103008-228

[Lys(Me2)79]-Histone H3 (69-89)-K,Biotin

Catalog Number: (103008-228)
Supplier: Anaspec
Description: This peptide is Histone H3 with amino acid residues 69 to 89 di-methylated at Lys-79 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)
MW:2862.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-MK181604

Benzyl alcohol ≥97%, AR®, Macron Fine Chemicals™

Catalog Number: (MK181604)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Benzyl alcohol ≥97%, AR®, Macron Fine Chemicals™

SDS Certificates


Product Image-CA71007-232

Ethanol denatured ≥80% (denatured with methanol and ethyl acetate)

Catalog Number: (CA71007-232)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: (DAG-2A)

SDS Certificates


Product Image-JT9403-26

(±)-1,2-Propanediol ≥99.5% USP, Multi-Compendial, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: (±)-1,2-Propanediol ≥99.5% USP, Multi-Compendial

SDS Certificates

Product Image-CAMK598420

Magnesium hydroxide 95.0-100.5%, white powder USP, FCC, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Powder.

Image Unavailable-103009-516

[Lys(Ac)40]-Ac-a-Tubulin (29-50)-WGK,Biotin

Catalog Number: (103009-516)
Supplier: Anaspec
Description: This is an acetylated alpha tubulin peptide at lysine 40 with a C-terminal WG linker followed by a biotinylated lysine. The acetylation at lysine 40 of this peptide is shown to have a therapeutic interest in diseases involving altered intracellular transport such as Huntington's disease. Histone Deacetylase (HDAC) inhibitors have been shown to increase vesicular transport of brain derived neurotrophic factor thereby increasing acetylation of tubulin at lysine 40.
Sequence: Ac-GIQPDGQMPSD-K(ac)-TIGGGDDSFNWG-K(biotin)
MW: 2918.2Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-MK301606

Methanol absolute, anhydrous ≥99.8% (by GC), AR® ACS, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Low acetone. Soluble in water.

SDS Certificates

Image Unavailable-A-3110.0005BA

Boc-β-t-butyl-L-alanine

Supplier: Bachem Americas
Description: Sequence: Boc-β-tBu-Ala-OH

Product Image-CAMK140319

Benzyl alcohol 98.0-100.5% NF, Macron Fine Chemicals™

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Benzyl alcohol 98.0-100.5% NF, Macron Fine Chemicals™

Certificates

Image Unavailable-103007-358

Human Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Biotin

Catalog Number: (103007-358)
Supplier: Anaspec
Description: This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-102968-326

Vitamin D3, 25-OH RIA, IBL America

Catalog Number: (102968-326)
Supplier: IBL-America
Description: Radioimmunoassay (RIA) for the determination of 25OH-Vit.D3 in human serum and heparin plasma.
Image Unavailable-E-2980.0005BA

1-(Triphenylmethyl)-L-histidine

Supplier: Bachem Americas
Description: Sequence: H-His(1-Trt)-OH

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,697 - 1,712 of 12,682
no targeter for Bottom