Print…

You Searched For: Formamidine+disulfide+dihydrochloride


3,981  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"3981"

Rate These Search Results

Image Unavailable-CAPIPA5-17954

TXNDC1/TMX Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (RSLGPSLATDKS) corresponding to the C-terminus amino acids of TMX1
Catalog Number: CAPIPA5-17954
Supplier: Thermo Scientific
Image Unavailable-103009-388

Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Description: Des-gamma-carboxylated Osteocalcin/Bone Gla Protein, Purity: HPLC >/= 95%, MW: 5797.5, Sequence: [YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)] biotin - labeled, Store: -20 deg C, Size: 0.25mg
Catalog Number: 103009-388
Supplier: Anaspec Inc
Image Unavailable-76303-592

Recom >/= 98% E.coli Human GDF-3 50UG

Description: Animal-Free Human GDF-3, Recombinat, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses, Host: E.coli, member of the TGF-beta superfamily of growth and differentiation factors, and is highly homologous to GDF-9, Synonyms: UNQ2222/PRO248, Size: 50UG
Catalog Number: 76303-592
Supplier: Peprotech
Product Image-10788-222

Recombinant Mouse Epidermal Growth Factor EGF) contains 53 AAs

Description: Recombinant Mouse Epidermal Growth Factor EGF) contains 53 AAs, with a MW of 6 kDa, Activity: dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 0.1 ng/mL, Source: E.coli, Synonym: Urogastrone, URG, 100UG
Catalog Number: 10788-222
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Product Image-10788-224

Recombinant Mouse Epidermal Growth Factor (EGF) contains 53 AAs

Description: Recombinant Mouse Epidermal Growth Factor (EGF) contains 53 AAs, with a MW of 6 kDa, Activity: dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 0.1 ng/mL, Source: E.coli, Synonyms: Urogastrone, URG, 1MG
Catalog Number: 10788-224
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Product Image-10788-226

Recombinant Mouse Epidermal Growth Factor EGF) contains 53 AAs

Description: Recombinant Mouse Epidermal Growth Factor EGF) contains 53 AAs, with a MW of 6 kDa, Activity: dose-dependent proliferation of mouse BALB/c 3T3 cells and is typically less than 0.1 ng/mL, Source: E.coli, Synonym: Urogastrone, URG, 500UG
Catalog Number: 10788-226
Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Product Image-10459-162

RUBISCO Antibody

Description: RUBISCO Polyclonal Antibody, Host: Rabbit , Isotype: IgG, Species: Plant (Arabidopsis thaliana), Synonymns: rbcL; RBL_SPIOL, Application: IHC-P, IF(IHC-P), 100ul
Catalog Number: 10459-162
Supplier: Bioss
Image Unavailable-10488-714

FACTOR XI LIGHT CHAIN Antibody

Description: Factor XI light chain Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Mouse, Rat,Unconjugated, Isotype: IgG, Application: WB, IHC-P, IF, Synonymns: Coagulation factor XI; Coagulation factor XIa light chain, 100ul
Catalog Number: 10488-714
Supplier: Bioss
Image Unavailable-10072-564

PDGF-AB Recombinant Protein, Species: Human, Host: E. coli

Catalog Number: 10072-564
Supplier: Prosci
Image Unavailable-10073-062

GDF-5 Recombinant Protein, Species: Murine, Host: E. coli

Description: BMP-14, Cartilage-Derived Morphogenetic Protein-1 (CDMP-1)
Catalog Number: 10073-062
Supplier: Prosci
Image Unavailable-89359-704

Mouse Monoclonal antibody to ERp57 (protein disulfide isomerase family A, member 3)

Description: Clone: MaP.Erp57 Purity: Protein G purified Species Reactivity: Human, Mouse, Dog, Hamster, Monkey, Pig Tested Applications: IP, WB Pkg Size: 50 ug
Catalog Number: 89359-704
Supplier: Genetex
Image Unavailable-H-4448.1000BA

CART (61-102) (HUMAN, RAT), 1mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART

Description: CART (61-102) (HUMAN, RAT), 1mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART
Catalog Number: H-4448.1000BA
Supplier: Bachem Americas
Image Unavailable-H-4448.0500BA

CART (61-102) (HUMAN, RAT), 0.5mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART

Description: CART (61-102) (HUMAN, RAT), 0.5mg (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) CAS: 209615-75-8 C189H310N58O56S7 FW: 4515.36. CART
Catalog Number: H-4448.0500BA
Supplier: Bachem Americas
Image Unavailable-CA80601-672

Competent Cells, Rosetta-gami™ B Competent Cells

Description: Competent Cells, Rosetta-gami™ B Competent Cells
Catalog Number: CA80601-672
Supplier: MilliporeSigma

Certificates


Image Unavailable-CA80601-670

Competent Cells, Rosetta-gami™ B Competent Cells

Description: Competent Cells, Rosetta-gami™ B Competent Cells
Catalog Number: CA80601-670
Supplier: MilliporeSigma

Certificates


Image Unavailable-CA80511-904

Anti-Fibronectin (Ab-3) Mouse Monoclonal Antibody [clone: FBN11]

Description: Anti-Fibronectin (Ab-3) Mouse Monoclonal Antibody [clone: FBN11]
Catalog Number: CA80511-904
Supplier: MilliporeSigma
1,121 - 1,136 of 3,981