You Searched For: Formamidine+disulfide+dihydrochloride

Supplier: Peprotech

Description: IFN-ω is a type I interferon that can be induced by virus-infected leukocytes. Members of the type I interferon family, which includes IFN-α, IFN-β, and IFN-ω, signal through the IFNAR-1/IFNAR-2 receptor complex, and exert antiviral and antiproliferative activities. IFN-ω exhibits about 75% sequence homology with IFN-α, and contains two conserved disulfide bonds that are necessary for full biological activity. Recombinant Human IFN-ω is a 19.9 kDa protein consisting of 172 amino acid residues.

Supplier: Biosensis

Description: X63-saporin is an antibody conjugate comprising of the non-specific monoclonal IgG1 antibody X63, chemically conjugated via a reducible disulfide bridge to the ribosome-inactivating protein saporin, purified from saponaria officinalis. Antibody clone X63 has no known binding ability, and thus can be used as negative control antibody. In combination with saporin, X63-saporin is a useful negative control for targeting IgG1-saporin conjugates such as MC192-saporin.

Catalog Number: (CAPIPA526250)

Supplier: Thermo Scientific

Description: This antibody is predicted to react with bovine based on sequence homology. Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.

Catalog Number: (103009-490)

Supplier: Anaspec Inc

Description: This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. It is cyclized through a disulfide bond. Thrombospondin is a matrix-bound glycoprotein involved in cancer metastasis, tumor adhesion, and angiogenesis. This peptide has been shown to competitively inhibit platelet aggregation and tumor metastasis.
Sequence:CSVTCG (S-S Bonded)
MW:566.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103003-366)

Supplier: Anaspec Inc

Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
MW:5155.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Prosci

Description: Activin A is a TGF-β family member that exhibits a wide range of biological activities including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in post-menopausal woman have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, Follistatin. Human Activin A is a 26.0 kDa disulfide-linked homodimer of two β A chains, each containing 116 amino acid residues.

Certificates

Catalog Number: (10098-398)

Supplier: Prosci

Description: BMPs (bone morphogenetic proteins) belong to the TGF beta superfamily of structurally related signaling proteins. Members of this superfamily are widely represented throughout the animal kingdom and have been implicated in a variety of developmental processes. Proteins of the TGF beta superfamily are disulfide-linked dimers composed of two 12-15 kDa polypeptide chains. As implied by their name, BMPs initiate, promote and regulate bone development, growth, remodeling and repair.

Catalog Number: (10072-564)

Supplier: Prosci

Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-B. PDGFR-a is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-B interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids).

Catalog Number: (77439-550)

Supplier: Bioss

Description: Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity). Subunit : Homodimer; disulfide-linked. Binds to RET.

Supplier: Peprotech

Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, six human β-defensins have been identified; BD-1, BD-2, BD-3, BD-4, BD-5 and BD-6. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they can act as chemoattractants towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors, and are released by proteolytic cleavage of a signal sequence and, in some cases, a propeptide sequence. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. BD-4 is expressed in the testes, stomach, uterus, neutrophils, thyroid, lungs and kidneys. In addition to its direct antimicrobial activities, BD-4 is chemoattractant towards human blood monocytes. Recombinant Human BD-4 is a 6.0 kDa protein containing 50 amino acid residues.

Catalog Number: (76303-584)

Supplier: Peprotech

Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules, and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is a high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant Human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two beta chains (218 total amino acids).

Catalog Number: (10073-012)

Supplier: Prosci

Description: Amphiregulin is an EGF related growth factor that signals through the EGF/TGF-a receptor, and stimulates growth of keratinocytes, epithelial cells and some fibroblasts. Amphiregulin also inhibits the growth of certain carcinoma cell lines. Synthesized as a transmembrane protein, Amphiregulin’s extracellular domain is proteolytically processed to release the mature protein. There are 6 conserved cysteine residues, which form 3 intramolecular disulfide bonds essential for biological activity. Recombinant human Amphiregulin is a 11.3 kDa glycoprotein consisting of 98 amino acid residues.

Catalog Number: (10072-700)

Supplier: Prosci

Description: VEGF-D, a member of the VEGF/PDGF family of structurally related proteins, is a potent angiogenic cytokine. It promotes endothelial cell growth, promotes lymphangiogesis, and can also affect vascular permeability. VEGF-D is highly expressed in the lung, heart, small intestine and fetal lung, and at lower levels in the skeletal muscle, colon, and pancreas. It forms cell surfaced-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. During embryogenesis, VEGF-D may play a role in the formation of the venous and lymphatic vascular systems. It also participates in the growth and maintenance of differentiated lymphatic endothelium in adults. Both VEGF-C and VEGF-D are over-expressed in certain cancers, and the resulting elevated levels of VEGF-C or VEGF-D tend to correlate with increased lymphatic metastasis. Recombinant human VEGF-D is a 13.1 kDa non-disulfide linked homodimeric protein consisting of two 117 amino acid polypeptide chains. Due to glycosylation the protein migrates as a 20.0-22.0 kDa band under non-reducing condition.

Catalog Number: (10797-470)

Supplier: Prosci

Description: Crystallizable fragments composed of the carboxy-terminal halves of both IMMUNOGLOBULIN HEAVY CHAINS linked to each other by disulfide bonds. Fc fragments contain the carboxy-terminal parts of the heavy chain constant regions that are responsible for the effector functions of an immunoglobulin (COMPLEMENT fixation, binding to the cell membrane via FC RECEPTORS, and placental transport). IgG1 Fc was reported has a novel role as a potential anti-inflammatory drug for treatment of human autoimmune diseases.

Catalog Number: (103003-364)

Supplier: Anaspec Inc

Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (89350-904)

Supplier: Genetex

Description: Brain natriuretic peptide (BNP) circulates in blood as a peptide hormone with natriuretic, vasodilatory and renin inhibitory properties. BNP is secreted predominantly by the left ventricular myocytes in response to volume expansion and pressure overload. BNP belongs to a family of structurally similar peptide hormones, which includes atrial natriuretic peptide (ANP), BNP, C-type natriuretic peptide (CNP) and urodilatin. These peptides are characterized by a common 17 amino acid ring structure with a disulfide bond between two cystein residues. This ring structure shows high homology between different natriuretic peptides (eleven of the 17 amino acid residues are homologous in the ring of each of the natriuretic peptides, see fig. 18). BNP is a 32 amino acid peptide with disulfide bond between the cystein residues Cys10 and Cys26. In earlier studies it has been demonstrated that BNP concentration in blood increases with the severity of congestive heart failure. Quantitative measurement of BNP in blood provides an objective indicator of congestive heart failure severity.