You Searched For: Formamidine+disulfide+dihydrochloride

Catalog Number: (10389-184)

Supplier: Bioss

Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).

Catalog Number: (89351-270)

Supplier: Genetex

Description: VEGF (Vascular Endothelial Growth Factor) is a homodimeric, disulfide-linked glycoprotein involved in angiogenesis which promotes tumor progression and metastasis. It exhibits potent mitogenic and permeability inducing properties specific for the vascular endothelium. Of the four isoforms of VEGF, the smaller two, VEGF 165 and VEGF 121, are secreted proteins and act as diffusible agents, whereas the larger two (VEGF 189 and VEGF 206) remain cell associated.

Catalog Number: (89351-630)

Supplier: Genetex

Description: VEGF (Vascular Endothelial Growth Factor) is a homodimeric, disulfide-linked glycoprotein involved in angiogenesis which promotes tumor progression and metastasis. It exhibits potent mitogenic and permeability inducing properties specific for the vascular endothelium. Of the four isoforms of VEGF, the smaller two, VEGF 165 and VEGF 121, are secreted proteins and act as diffusible agents, whereas the larger two (VEGF 189 and VEGF 206) remain cell associated.

Catalog Number: (75843-110)

Supplier: BIOGEMS INTERNATIONAL INC.

Description: The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.

Catalog Number: (75843-116)

Supplier: BIOGEMS INTERNATIONAL INC.

Description: The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.

Catalog Number: (10389-162)

Supplier: Bioss

Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).

Catalog Number: (10782-408)

Supplier: Biosensis

Description: DBH is an oxireductase belonging to the copper type II ascorbate-dependent monooxygenase family. DBH exists as a homotetramer composed of two non-covalently bound disulfide-linked dimers. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It binds 2 copper ions and 1 PQQ per subunit . Depending on the presence of a signal peptide, DBH can exist in both soluble and membrane-bound forms.

Catalog Number: (10084-106)

Supplier: Proteintech

Description: Cathepsin H (CTSH, synonyms: CPSB, MGC1519, minichain) is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. This protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors.

Catalog Number: (10098-258)

Supplier: Prosci

Description: BMPs (bone morphogenetic proteins) belong to the TGF beta superfamily of structurally related signaling proteins. Members of this superfamily are widely represented throughout the animal kingdom and have been implicated in a variety of developmental processes. Proteins of the TGF beta superfamily are disulfide-linked dimers composed of two 12-15 kDa polypeptide chains. As implied by their name, BMPs initiate, promote and regulate bone development, growth, remodeling and repair.

Catalog Number: (10104-164)

Supplier: Prosci

Description: Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Catalog Number: (75788-764)

Supplier: Prosci

Description: Epidermal growth factor (EGF) is a small mitogenic protein that is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing. This protein shows both strong sequential and functional homology with human type-alpha transforming growth factor (hTGF alpha), which is a competitor for EGF receptor sites. EGF is a small 53 amino acid residue long protein that contains three disulfide bridges

Catalog Number: (89360-516)

Supplier: Genetex

Description: Protein C is a vitamin K-dependent serine protease zymogen. Purified human activated protein C selectively destroys factors Va and VIII:C in human plasma and thus has an important anticoagulant role. Protein C deficiency has been associated with inherited thrombophilia. In its primary structure, protein C is similar to the prothrombin group of blood coagulation factors. It most closely resembles factor X and has light and heavy polypeptide chains linked by disulfide bridges.

Catalog Number: (103003-050)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103003-048)

Supplier: Anaspec Inc

Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (10097-920)

Supplier: Prosci

Description: BMPs (bone morphogenetic proteins) belong to the TGF beta superfamily of structurally related signaling proteins. Members of this superfamily are widely represented throughout the animal kingdom and have been implicated in a variety of developmental processes. Proteins of the TGF beta superfamily are disulfide-linked dimers composed of two 12-15 kDa polypeptide chains. As implied by their name, BMPs initiate, promote and regulate bone development, growth, remodeling and repair.

Supplier: Bachem Americas

Description: C-ANF 4-23 binds with high affinity to approximately 99% of ANF receptors in the isolated perfused rat kidney. It competes effectively with biologically active atrial peptides for binding sites but is devoid of agonist or antagonist action on the generation of cGMP in vascular smooth muscle and endothelial cells in culture.