You Searched For: ZnAF-1+DA


3,681  results were found

SearchResultCount:"3681"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (102999-808)
Supplier: Anaspec Inc
Description: Sequence: KKPYIL
MW: 761 Da
% peak area by HPLC: 95%
Storage condition: -20°C


Catalog Number: (103009-474)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-35).
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
MW:3551.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102996-340)
Supplier: Anaspec Inc
Description: This is an integrin-binding peptide.
Sequence:GRGDTP
MW:601.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (CAPIPA5-13416)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with bovine and rat based on sequence homology. Parkinson's disease (PD) is a multifactorial disease that appears to arise from the effects of both genetic and environmental influences. The known genetic factors include multiple genes that have been identified in related parkinsonian syndromes, as well as alpha-synuclein. Genes associated with either PD or Parkinson-related disorders include parkin, DJ-1, ubiquitin C-terminal hydrolase isozyme L1 (UCH-L1), nuclear receptor-related factor 1 (NURR1), and alpha-synuclein. Nurr1 is a transcription factor that is expressed in the embryonic ventral midbrain and is critical for the development of dopamine (DA) neurons. It belongs to the conserved family of nuclear receptors but lacks an identified ligand and is therefore referred to as an orphan receptor. RXR ligands can promote the survival of DA neurons via a process that depends on Nurr1-RXR heterodimers. In developing DA cells, Nurr1 is required for the expression of several genes important for DA synthesis and function. Nurr1 is also important for the maintenance of adult DA neurons.


Catalog Number: (102999-768)
Supplier: Anaspec Inc
Description: This is biotinylated Bradykinin peptide.
Sequence:Biotin-RPPGFSPFR
MW:1286.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103006-882)
Supplier: Anaspec Inc
Description: This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102999-366)
Supplier: Anaspec Inc
Description: This is a CGRP receptor antagonist.
Sequence:VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
MW:3125.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: An inhibitor of cell attachment to salmosin and vitronectin.
Sequence:GRGDSP
MW:587.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-172)
Supplier: Anaspec Inc
Description: This peptide is a negative control for cGRGDSP
Sequence:Cyclo-[GRGESP]
MW:582 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103003-342)
Supplier: Anaspec Inc
Description: This thrombin receptor agonist peptide is a PAR 1 antagonist peptide.
Sequence:FLLRN
MW:661.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103007-766)
Supplier: Anaspec Inc
Description: This is a peptide inhibitor of collagen fibrillar matrix assembly.
Sequence:SAGFDFSFLPQPPQEKAHDGGRYYRA
MW:2942.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-750)
Supplier: Anaspec Inc
Description: This is a control peptide for gp91 ds-tat.
Sequence: YGRKKRRQRRRCLRITRQSR-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103006-682)
Supplier: Anaspec Inc
Description: This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).
Sequence:[protein fragment, 39 aa]
MW:4771.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-450)
Supplier: Anaspec Inc
Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGTGMKKTSFQRAKS
MW:2187.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-452)
Supplier: Anaspec Inc
Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGSGAKKTSFRRAKQ
MW:2182.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (102998-830)
Supplier: Anaspec Inc
Description: A vesicular stomatitis virus G (VSV-G) protein fragment.
Sequence:YTDIEMNRLGK
MW:1339.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
no targeter for Bottom