You Searched For: Sulfo-NHS-LC-Biotin


19,992  results were found

SearchResultCount:"19992"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CA11029-080)
Supplier: Rockland Immunochemical
Description: Anti-Deoxyribonuclease I (Bovine Pancreas) (Rabbit) Antibody Biotin Conjugated - Anti-Deoxyribonuclease I Has Been Assayed Against 1Ug Of Deoxyribonuclease I In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (CA11029-258)
Supplier: Rockland Immunochemical
Description: Anti-Glucose-6-Phosphate Dehydrogenase (Goat) Antibody Biotin Conjugated Has Been Assayed Against 1Ug Of Glucose-6-Phosphate Dehydrogenase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (103294-252)
Supplier: Novus Biologicals
Description: The SUSD2 Antibody (1279B) [Biotin] from Novus Biologicals is a rabbit monoclonal antibody to SUSD2. This antibody reacts with human, rat. The SUSD2 Antibody (1279B) [Biotin] has been validated for the following applications: Western Blot, Flow Cytometry.


Catalog Number: (CA11029-208)
Supplier: Rockland Immunochemical
Description: Anti-Carboxypeptidase Y (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1 Ug Of Carboxypeptidase Y In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (103008-518)
Supplier: Anaspec Inc
Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (CA11029-310)
Supplier: Rockland Immunochemical
Description: Anti-Lipoamide Dehydrogenase (Porcine Heart) (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1Ug Of Lipoamide Dehydrogenase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (103360-158)
Supplier: Novus Biologicals
Description: The PMS2 Antibody (163C1251) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to PMS2. This antibody reacts with human, mouse. The PMS2 Antibody (163C1251) [Biotin] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.


Catalog Number: (89495-116)
Supplier: Genscript
Description: THE™ V5 Tag antibody [Biotin], mAb, Mouse recognizes N-terminal and C-terminal V5 tagged fusion proteins.


Catalog Number: (103359-958)
Supplier: Novus Biologicals
Description: The DAP3 Antibody (42C617.1.2) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to DAP3. This antibody reacts with human, mouse. The DAP3 Antibody (42C617.1.2) [Biotin] has been validated for the following applications: Western Blot.


Catalog Number: (103359-930)
Supplier: Novus Biologicals
Description: The MBD1 Antibody (100B272.1) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to MBD1. This antibody reacts with human, mouse. The MBD1 Antibody (100B272.1) [Biotin] has been validated for the following applications: Western Blot.


Catalog Number: (CA11029-326)
Supplier: Rockland Immunochemical
Description: Anti-Penicillinase (Enterobacter Cloacae) (Rabbit) Antibody Biotin Conjugated - Anti-Penicillinase Antibody Has Been Assayed Against 1Ug Of Penicillinase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (CA11029-206)
Supplier: Rockland Immunochemical
Description: Anti-Ferritin (Rabbit) Antibody Biotin Conjugated - Anti-Ferritin Antibody Is Suitable For ELISA, Western Blot And Immunohistochemistry. Expect Band At 21.2 Kda In Appropriate Cell Lysate Or Extract.


Catalog Number: (102996-412)
Supplier: Anaspec Inc
Description: This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (ABCA_AB53494-1MG)
Supplier: Abcam
Description: Rabbit polyclonal to Biotin.

New Product


Catalog Number: (CA11029-302)
Supplier: Rockland Immunochemical
Description: Anti-Carboxypeptidase A (Rabbit) Antibody Biotin Conjugated - Anti-Carboxypeptidase A Has Been Assayed Against 1Ug Of Carboxypeptidase A In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (CA405601-BL)
Supplier: Biolegend
Description: Biotin Goat anti-hamster (Syrian) IgG [Poly4056]; Isotype: Goat Polyclonal IgG; Reactivity: Hamster; Apps: FC, ELISA, IHC, IF, WB; Size: 500 μg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,169 - 1,184 of 19,992
no targeter for Bottom