You Searched For: 4-Bromo-L-phenylalanine


587  results were found

Sort Results

List View Easy View
SearchResultCount:"587"
Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103003-726
Supplier: Anaspec Inc


Description: MMP-10 (stromelysin 2) cleaves extracellular matrix proteins, but is unable to cleave the triple-helical fibrillar collagens
Catalog Number: 103010-302
Supplier: Anaspec Inc


Description: TAFA proteins are a newly discovered family of proteins, which are distantly related to MIP-1α, a member of the CC-chemokine family. TAFA mRNAs are highly expressed in specific brain regions. The biological function of TAFA-2 is still unknown. Recombinant Human TAFA-2 is an 11.2 kDa protein consisting of 101 amino acid residues.
Catalog Number: 10774-090
Supplier: Peprotech


Description: MBD2 Peptide
Catalog Number: 77125-802
Supplier: Prosci


Description: TLR9 inhibitor
Catalog Number: 89153-118
Supplier: Enzo Life Sciences


Description: Human MBD3 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of human MBD3 in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number: 76733-666
Supplier: ANTIBODIES.COM LLC


Description: TLR9 ligand.
Catalog Number: 89153-096
Supplier: Enzo Life Sciences


Description: TLR9 ligand.
Catalog Number: 89153-094
Supplier: Enzo Life Sciences


Description: MagRack 6 is a magnetic rack for small-scale protein purification and sample enrichment with magnetic beads. Each rack consists of anodized aluminium housing (blue), detachable plastic bar (white) containing a neodymium magnet.
Catalog Number: CA89129-096
Supplier: Cytiva


Description: MeCP2 antibody, Host: Rabbit, Reacts with human, mouse, rat, Isotype: IgG1, Immunogen: synthetic peptide (REEPVDSRTPVTERVS, aa 471-486) of C-terminus of human protein, Synonyms: MeCp-2 protein; Store lyophilised a
Catalog Number: 76334-044
Supplier: Biosensis


Description: MeCP2 Monoclonal antibody, Clone: 4F11, Host: Mouse, Reacts with human, mouse, rat, Isotype: IgG1, Immunogen: Full-length recombinant human protein, Synonyms: MeCp-2 protein; MeCp2, Store lyophilised antibody at 2
Catalog Number: 76334-020
Supplier: Biosensis


Description: 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 102996-316
Supplier: Anaspec Inc


Description: TLR9 ligand.
Catalog Number: 89153-098
Supplier: Enzo Life Sciences


Description: Crosstide is a peptide analog of glycogen synthase kinase-3 (GSK-3) that functions as a natural substrate for Akt/PKB. It displays similar specificities towards PKBα, PKBβ and PKBγ isoforms. It is also recognized by MAPKAP kinase-1 and p70S6K. The fluorescent and biotinlyated peptides demonstrate similar enzyme activities.
Sequence:GRPRTSSFAEG
MW:1164.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103005-902
Supplier: Anaspec Inc


Description: Inactive (neutral) control.
Catalog Number: 89153-126
Supplier: Enzo Life Sciences


Description: Anti-MECP2 Rabbit Polyclonal Antibody
Catalog Number: 76761-062
Supplier: Prosci


353 - 368 of 587