Print…

You Searched For: 3-Pyridinesulphonic+acid


66,884  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"66884"

Rate These Search Results

Image Unavailable-CAAA32102-14

Digallium trioxide ≥99.99% (metals basis)

Description: In spectroscopic analysis
Catalog Number: CAAA32102-14
Supplier: Thermo Scientific Chemicals

Certificates


Product Image-22810-026

Combustion Boats, Alundum AN788, Saint Gobain

Description: Made of the alundum purest, 99% aluminum oxide in its basic state.
Catalog Number: 22810-026
Supplier: SAINT GOBAIN ABRASIVES
Image Unavailable-103007-366

Human [Met(O)35]-beta-Amyloid (1-42)

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-366
Supplier: Anaspec Inc
Image Unavailable-TCR0203-1G

Resazurin sodium salt ≥85.0% (by HPLC)

Description: Resazurin Sodium Salt, Purity: >85.0%(HPLC), CAS Number: 62758-13-8, Molecular Formula: C12H6NNaO4, Molecular Weight: 251.17, Synonyms: 7-Hydroxy-3H-phenoxazin-3-one N-Oxide Sodium Salt, Size: 5G
Catalog Number: TCR0203-1G
Supplier: TCI America

Certificates


Product Image-89150-864

NOR-3 ≥97% (by HPLC)

Description: Nitric oxide donor
Catalog Number: 89150-864
Supplier: Enzo Life Sciences
Image Unavailable-CA1.08101.1000

Tetrahydrofuran, LiChrosolv® for liquid chromatography, Supelco®

Description: Offering a high degree of UV transmittance, low particle count, low acidity and alkalinity, and low evaporation residue level, LiChrosolv® solvents are ideal for reproducible separations. They are produced from specially selected raw materials, and undergo a number of purification steps prior to final packaging. Since separations are normally carried out under gradient conditions in analytical HPLC, Merck Millipore offer solvents in ’gradient grade’ as well as ’isocratic grade’. This enables you to minimise the gradient effect of the solvent involved.
Catalog Number: CA1.08101.1000
Supplier: MilliporeSigma

SDS Certificates


Product Image-76709-498

Rat Neuronal Nitric Oxide Synthase(nNOS) ELISA Kit

Description: Rat Neuronal Nitric Oxide Synthase(nNOS) ELISA Kit
Catalog Number: 76709-498
Supplier: AFG Bioscience
Image Unavailable-10167-662

Anti-CAMK2 Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody against the oxidized M281/282 form of CAMKII
Catalog Number: 10167-662
Supplier: Genetex
Image Unavailable-CA80053-400

Anti-NOS Rabbit Polyclonal Antibody

Description: Primary Rabbit Anti-Nitric Oxide Synthase (1131-1144), Inducible Reacts with Human, Mouse, Rat
Catalog Number: CA80053-400
Supplier: MilliporeSigma
Image Unavailable-CAAAAL07821-22

(±)-Epoxystyrene 98+%

Description: (±)-Epoxystyrene 98+%
Catalog Number: CAAAAL07821-22
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA41786-09

Diboron trioxide ≥99.999% (metals basis)

Description: MDL: MFCD00011315
Catalog Number: CAAA41786-09
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA12358-22

Selenium dioxide ≥99.4% (metals basis)

Description: As an oxidizing agent, in manufacturing of other selenium compounds
Catalog Number: CAAA12358-22
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA42737-18

Silicon(IV) oxide, amorphous ≥99.8% S.A. 85-115 m²/g, fumed S.A. 85-115 m²/g

Description: Adhesives, sealants, silicones
Catalog Number: CAAA42737-18
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA14689-09

Niobium(V) ethanolate ≥99.999% (metals basis) (max. 0.05% Ta)

Description: Preparation of niobium oxide and mixed metal oxides
Soluble in organic solvents. Decomposes in water
Catalog Number: CAAA14689-09
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CA11027-362

Vanadyl sulfate hydrate ≥97%

Description: Vanadyl Sulfate, Hydrate is an inorganic compound of the trace mineral Vanadium. These materials may or may not have a Certificate of Analysis available.
Catalog Number: CA11027-362
Supplier: Spectrum Chemicals
Image Unavailable-TCT0249-500G

Titanyl(IV) acetylacetonate

Description: CAS Number: 14024-64-7
MDL Number: MFCD00013505
Molecular Formula: C10H14O5Ti
Molecular Weight: 262.08
Form: Crystal
Color: Slightly Pale Yellow
Melting point (°C): 200
Catalog Number: TCT0249-500G
Supplier: TCI America

SDS Certificates


433 - 448 of 66,884