You Searched For: \u03B1-Bromo-4-nitrotoluene


37,720  results were found

Sort Results

List View Easy View
SearchResultCount:"37720"
Description: ADAR1 converts adenosine to inosine in dsRNA, which destabilizes the dsRNA helix. This activity is important for various functions like site-specific RNA editing of transcripts of the glutamate receptors and modifying viral RNA genomes (which may be responsible for hypermutation of certain negative-stranded viruses, e.g., measles virus). ADAR1 also binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. This protein is ubiquitously expressed, with the highest levels being found in brain and lung.
Catalog Number: 10325-164
Supplier: Bioss


Description: ADAR1 converts adenosine to inosine in dsRNA, which destabilizes the dsRNA helix. This activity is important for various functions like site-specific RNA editing of transcripts of the glutamate receptors and modifying viral RNA genomes (which may be responsible for hypermutation of certain negative-stranded viruses, e.g., measles virus). ADAR1 also binds to short interfering RNAs (siRNA) without editing them and suppresses siRNA-mediated RNA interference. This protein is ubiquitously expressed, with the highest levels being found in brain and lung.
Catalog Number: 10325-162
Supplier: Bioss


Description: VKORC1 Antibody: Vitamin K epoxide reductase complex subunit 1 (VKORC1) is the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form which is essential for blood clotting. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is VKORC1 that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance.
Catalog Number: 10751-600
Supplier: Prosci


Description: PSD-95 is a very prominent component of the postsynaptic densities of synapses. It contains three PDZ domains which play key roles in its interactions with other proteins in the synapse. It has been proposed that these PDZ domains organize glutamate receptors and their associated signaling proteins and determine the size and strength of synapses (Kim and Sheng, 2004). Recent work suggests that interaction of the NMDAR with PSD-95 via these PDZ domains can be regulated by phosphorylation (Chung et al., 2004).
Catalog Number: 10075-468
Supplier: Prosci


Description: Rabbit polyclonal antibody to GLUD2 (N-terminal)
Catalog Number: 89267-206
Supplier: Genetex


Description: Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: 77049-472
Supplier: ANTIBODIES.COM LLC


Description: Rabbit polyclonal antibody to GluR1 for WB, IHC, IF and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: 77049-476
Supplier: ANTIBODIES.COM LLC


Description: Rabbit Polyclonal Antibody to GRIA2
Catalog Number: 89366-258
Supplier: Genetex


Description: Mouse Monoclonal antibody [S59-36] to NR2B
Catalog Number: 89265-980
Supplier: Genetex


Description: Rabbit polyclonal antibody to GRM7 for WB and ELISA with samples derived from Human, Mouse and Rat.
Catalog Number: 77060-996
Supplier: ANTIBODIES.COM LLC


Description: Rabbit polyclonal antibody to GRM1
Catalog Number: 89294-810
Supplier: Genetex


Description: Goat polyclonal antibody to GRM7
Catalog Number: 89294-696
Supplier: Genetex


Description: Rabbit Polyclonal antibody to mGluR3
Catalog Number: 10795-304
Supplier: Genetex


Description: Rabbit polyclonal to GOT1 (N-term)
Catalog Number: 89302-970
Supplier: Genetex


Description: Rabbit Polyclonal antibody to GAD65
Catalog Number: 89306-706
Supplier: Genetex


Description: This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-114
Supplier: Anaspec Inc


241 - 256 of 37,720