You Searched For: Phosphoryl+tribromide


5,297  results were found

Sort Results

List View Easy View
SearchResultCount:"5297"
Description: TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.[supplied by OMIM]
Catalog Number: CAPIPA5-15302
Supplier: Thermo Scientific


Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 102996-094
Supplier: Anaspec Inc


Description: Rabbit Polyclonal antibody to CaMKI gamma (calcium/calmodulin-dependent protein kinase IG)
Catalog Number: 89319-850
Supplier: Genetex


Description: Human CACNa1B (Calcium Channel, Voltage Dependent, N-Type, Alpha 1B Subunit) ELISA Kit
Catalog Number: 77518-958
Supplier: AFG Bioscience


Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons. It belongs to the calbindin family. Calbindin 2 (calretinin), closely related to calbindin 1, is an intracellular calcium-binding protein belonging to the troponin C superfamily. Calbindin 1 is known to be involved in the vitamin-D-dependent calcium absorption through intestinal and renal epithelia, while the function of neuronal calbindin 1 and calbindin2 is poorly understood. The sequence of the calbindin 2 cDNA reveals an open reading frame of 271 codons coding for a protein of 31,520 Da, and shares 58% identical residues with human calbindin1.
Catalog Number: 10230-228
Supplier: Bioss


Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons. It belongs to the calbindin family. Calbindin 2 (calretinin), closely related to calbindin 1, is an intracellular calcium-binding protein belonging to the troponin C superfamily. Calbindin 1 is known to be involved in the vitamin-D-dependent calcium absorption through intestinal and renal epithelia, while the function of neuronal calbindin 1 and calbindin2 is poorly understood. The sequence of the calbindin 2 cDNA reveals an open reading frame of 271 codons coding for a protein of 31,520 Da, and shares 58% identical residues with human calbindin1.
Catalog Number: 10230-226
Supplier: Bioss


Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons. It belongs to the calbindin family. Calbindin 2 (calretinin), closely related to calbindin 1, is an intracellular calcium-binding protein belonging to the troponin C superfamily. Calbindin 1 is known to be involved in the vitamin-D-dependent calcium absorption through intestinal and renal epithelia, while the function of neuronal calbindin 1 and calbindin2 is poorly understood. The sequence of the calbindin 2 cDNA reveals an open reading frame of 271 codons coding for a protein of 31,520 Da, and shares 58% identical residues with human calbindin1.
Catalog Number: 10230-224
Supplier: Bioss


Description: Mouse monoclonal [S100A13/7484] antibody to S100 Calcium Binding Protein A13/S100A13 for IHC-P with samples derived from Human.
Catalog Number: 77178-052
Supplier: ANTIBODIES.COM LLC


Description: This biotinylated ω-conotoxin GVIA is a useful ligand for the characterization of calcium channels.
Catalog Number: H-6132.0500BA
Supplier: Bachem Americas


Description: Mouse monoclonal [S100A13/7483] antibody to S100 Calcium Binding Protein A13/S100A13 for IHC-P with samples derived from Human.
Catalog Number: 77178-050
Supplier: ANTIBODIES.COM LLC


Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons. It belongs to the calbindin family. Calbindin 2 (calretinin), closely related to calbindin 1, is an intracellular calcium-binding protein belonging to the troponin C superfamily. Calbindin 1 is known to be involved in the vitamin-D-dependent calcium absorption through intestinal and renal epithelia, while the function of neuronal calbindin 1 and calbindin2 is poorly understood. The sequence of the calbindin 2 cDNA reveals an open reading frame of 271 codons coding for a protein of 31,520 Da, and shares 58% identical residues with human calbindin1.
Catalog Number: 10230-230
Supplier: Bioss


Description: Calretinin is a calcium-binding protein which is abundant in auditory neurons. It belongs to the calbindin family. Calbindin 2 (calretinin), closely related to calbindin 1, is an intracellular calcium-binding protein belonging to the troponin C superfamily. Calbindin 1 is known to be involved in the vitamin-D-dependent calcium absorption through intestinal and renal epithelia, while the function of neuronal calbindin 1 and calbindin2 is poorly understood. The sequence of the calbindin 2 cDNA reveals an open reading frame of 271 codons coding for a protein of 31,520 Da, and shares 58% identical residues with human calbindin1.
Catalog Number: 10230-212
Supplier: Bioss


Description: Murexide Indicator, 0.2 Percent (w/w) in Sodium Chloride, Powder Mixture, For Calcium, APHA is used as a colorimetric reagent for the measurement of rare earth metals and of calcium. As an APHA certified solution, this item meets the ASTM D1209 standards and can be used in water and waste water treatment facilities to determine the concentration of dissolved and particulate materials. Spectrum Chemical manufactured APHA grade products meet the toughest regulatory standards for quality and purity.
Catalog Number: CA11027-336
Supplier: Spectrum Chemicals

Description: Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)
Catalog Number: 89355-586
Supplier: Genetex


Description: Useful in cell activation experiments when calcium dose-response data are not required.
Catalog Number: CA80055-586
Supplier: MilliporeSigma

Description: CaBP8 Antibody: Calcium binding proteins (CaBP) play a crucial role in the calcium-mediated cellular signal transduction pathway in the central nervous system. The CaBP family shares much similarity with CaM I (calmodulin), and it has been shown that CaBP proteins can substitute functionally for, and possibly augment the function of, CaM I. CaBP8, contains two EF-hand domains for calcium binding and shares 70% homology with CaBP7 and 50% homology with CaM I. It negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity. Both CaBP8 and CaBP7 possess a targeting mechanism that is unique amongst the CaBPs that may contribute to differential functional Ca2+-sensing by these family members.
Catalog Number: 89417-544
Supplier: Prosci


577 - 592 of 5,297