Print…

You Searched For: DISTRIBUTION+RESULTS,+INC.


50,640  results were found

Refine Results Sort by
SearchResultCount:"50640"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10667-160

Anti-Tankyrase Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10667-160)
Supplier: Bioss
Description: Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation (PARsylation) of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates PARsylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates PARsylation of TERF1, thereby contributing to the regulation of telomere length. Involved in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. May be involved in spindle pole assembly through PARsylation of NUMA1. Stimulates 26S proteasome activity.
Image Unavailable-10469-172

Anti-MYO7A Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10469-172)
Supplier: Bioss
Description: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. In the retina, plays an important role in the renewal of the outer photoreceptor disks. Plays an important role in the distribution and migration of retinal pigment epithelial (RPE) melanosomes and phagosomes, and in the regulation of opsin transport in retinal photoreceptors. In the inner ear, plays an important role in differentiation, morphogenesis and organization of cochlear hair cell bundles. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity (By similarity). Motor protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.
Image Unavailable-10468-902

Anti-MYO7A Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10468-902)
Supplier: Bioss
Description: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails bind to membranous compartments, which are then moved relative to actin filaments. In the retina, plays an important role in the renewal of the outer photoreceptor disks. Plays an important role in the distribution and migration of retinal pigment epithelial (RPE) melanosomes and phagosomes, and in the regulation of opsin transport in retinal photoreceptors. In the inner ear, plays an important role in differentiation, morphogenesis and organization of cochlear hair cell bundles. Involved in hair-cell vesicle trafficking of aminoglycosides, which are known to induce ototoxicity (By similarity). Motor protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal hearing.
Image Unavailable-10404-952

Anti-Keratan Sulfate Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10404-952)
Supplier: Bioss
Description: Catalyzes the transfer of sulfate to position 6 of galactose residues of keratan. It has a preference for sulfating keratan sulfate, but it also transfers sulfate to the unsulfated polymer. The sulfotransferase activity on sialyl LacNAc structures is much higher than the corresponding desialylated substrate, and only internal galactose residues are sulfated. It also may function in the sulfation of sialyl N-acetyllactosamine oligosaccharide chains attached to glycoproteins. It participates in biosynthesis of selectin ligands. Selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Aggrecan is the major proteoglycan of human articular cartilage. The core protein is substituted by a number of keratan sulfate and chondroitin sulfate glycosaminoglycan chains. Whereas chondroitin sulfate is widely distributed throughout the body, keratan sulfate is primarily expressed in cartilage (joints, trachea, intervertebral discs) and cornea.
Product Image-89032-100

VWR® Standard 5000 Standard Orbital Shaker

Catalog Number: (89032-100)
Supplier: VWR International
Description: Analog orbital shakers are designed for a wide variety of applications including bacterial suspensions, staining/destaining, general mixing, and cell culture procedures requiring accurate and reproducible results.

Product available on GSA Advantage®


Image Unavailable-CAPIPA5-18956

Anti-RELMbeta Goat Polyclonal Antibody

Catalog Number: (CAPIPA5-18956)
Supplier: Thermo Scientific
Description: A family of resistin-like molecules (RELMs) has been identified in rodents and humans. Resistin is a hormone produced by fat cells. RELM alpha is a secreted protein that has a restricted tissue distribution with highest levels in adipose tissue. Another family member, RELM beta, is a secreted protein expressed only in the gastrointestinal tract, particularly the colon, in both mouse and human. RELM beta gene expression is highest in proliferative epithelial cells and is markedly increased in tumors, suggesting a role in intestinal proliferation. Resistin and the RELMs share a cysteine composition and other signature features. Thus, the RELMs together with resistin comprise a class of tissue-specific signaling molecules.
Product Image-10084-454

Anti-CRHR1 Rabbit Polyclonal Antibody

Catalog Number: (10084-454)
Supplier: Proteintech
Description: Corticotropin-releasing hormone (CRH, also known as Corticotropin-releasing factor, CRF) is a 41 amino acid peptide hormone and a key regulator of the stress response. CRH and the related urocortin peptides (UCN, UCN2 and UCN3) mediate their actions through two mammalian receptor subtypes, CRHR1 and CRHR2 . CRHR1 (also known as CRFR1) exhibits high affinity towards CRH and UCN but low affinity towards UCN2 and no affinity towards UCN3 . The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Widely distributed through out the brain, CRHR1 critically controls behavioral adaptation to stress and is causally linked to emotional disorders .
Image Unavailable-CAPIPA525979

Anti-FGFR1 Rabbit Polyclonal Antibody

Catalog Number: (CAPIPA525979)
Supplier: Thermo Scientific
Description: FGFR1 is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction.
Image Unavailable-CAPIPA5-18593

Anti-PICK1 Goat Polyclonal Antibody

Catalog Number: (CAPIPA5-18593)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with bovine, canine, human and porcine based on sequence homology. The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha . This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene.
Product Image-10087-472

Anti-GDI2 Mouse Monoclonal Antibody [clone: 4B8F3]

Catalog Number: (10087-472)
Supplier: Proteintech
Description: GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. . This antibody can bind both GDIs for the close sequences.
Image Unavailable-102996-408

Human Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide,Biotin

Catalog Number: (102996-408)
Supplier: Anaspec Inc
Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-CAPIPA5-18099

Anti-ACSL4 Goat Polyclonal Antibody

Catalog Number: (CAPIPA5-18099)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with bovine, canine, mouse, porcine and rat based on sequence homology. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.
Image Unavailable-10489-282

Anti-PSMD7 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10489-282)
Supplier: Bioss
Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 17.
Image Unavailable-10489-284

Anti-PSMD7 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10489-284)
Supplier: Bioss
Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 17.
Product Image-10087-470

Anti-GDI1 Rabbit Polyclonal Antibody

Catalog Number: (10087-470)
Supplier: Proteintech
Description: GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family. GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI1 is expressed primarily in neural and sensory tissues and also in secretory cells, displaying a diffuse, cytoplasmic distribution in cells. It runs as a 55kda protein in SDS-PAGE. . Defects in GDI1 are the cause of mental retardation X-linked type 41 (MRX41). Defects in GDI1 are the cause of mental retardation X-linked type 48 (MRX48). The antibody is specific to GDI1. And it has no cross reaction to GDI2.
Product Image-10090-114

Anti-MEF2C Rabbit Polyclonal Antibody

Catalog Number: (10090-114)
Supplier: Proteintech
Description: MEF2C belongs to the MEF2 family. It is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. MEF2C controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. It plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. It is crucial for normal neuronal development, distribution, and electrical activity in the neocortex and is necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. This protein is required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. It may also be involved in neurogenesis and in the development of cortical architecture.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,265 - 1,280 of 50,640
no targeter for Bottom