You Searched For: DISTRIBUTION+RESULTS,+INC.


100,035  results were found

Sort Results

List View Easy View
SearchResultCount:"100035"
Description: Expert* EFL10ST Sterilized Filter Tip, Tip Length: 45.34 mm, Features:, Graduations at 2, 5 and 10 uL, free of Human DNA, RNase, DNase, PCR Inhibitors and Pyrogens, patented, low-retention polymer, Color-coded, Economical, Volume Range: 0.1 - 10 uL
Catalog Number: 76178-334
Supplier: GILSON, INC.


Description: [Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV, Purity: HPLC >/= 95%, naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor, Molecular Weight: 4328.9, Size: 0.5 mg
Catalog Number: 103007-210
Supplier: Anaspec Inc


Description: Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)
Catalog Number: 103003-074
Supplier: Anaspec Inc


Description: Polyclonal, Host: Rabbit, Species: Human, Mouse, Immunogen: Antibody produced in rabbits immunized with a synthetic peptide corresponding a region of human SULT2B1, Applications: ELISA, WB, 50 ug
Catalog Number: 10103-484
Supplier: Prosci


Description: Foxp3, Monoclonal Antibody, Clone: 3G3, Host: Mouse, Species Reactivity: Mouse, Isotype: IgG1, kappa, Conjugate: FITC, Formulation: Phosphate-buffered aqueous solution, </=0.09% Sodium azide, may contain carrier protein/stabilizer, ph7.2, Application: FC, Size: 100ug
Catalog Number: 75842-598
Supplier: BIOGEMS INTERNATIONAL INC.


Description: Foxp3, Monoclonal Antibody, Clone: 3G3, Host: Mouse, Species Reactivity: Mouse, Isotype: IgG1, kappa, Conjugate: FITC, Formulation: Phosphate-buffered aqueous solution, </=0.09% Sodium azide, may contain carrier protein/stabilizer, ph7.2, Application: FC, Size: 25ug
Catalog Number: 75842-600
Supplier: BIOGEMS INTERNATIONAL INC.


Description: Transdermal Peptide, Sequence: ACSSSPSKHCG, short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin and enable macromolecular drugs to reach systemic circulation, Molecular Weight: 1063.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-172
Supplier: Anaspec Inc


Catalog Number: 76242-508
Supplier: Lewisbins+


Catalog Number: 76247-878
Supplier: Lewisbins+


Catalog Number: 76248-762
Supplier: Lewisbins+


Catalog Number: 76245-914
Supplier: Lewisbins+


Catalog Number: 76246-738
Supplier: Lewisbins+


Catalog Number: 76277-324
Supplier: Lewisbins+


Catalog Number: 76239-066
Supplier: Production Basics


Description: Polyclonal, Host: Rabbit, Species Reactivity: Human, Mouse, Rat, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human RNF5, purified by peptide affinity chromatography method, Application: ELISA, western blot, 50ug.
Catalog Number: 10104-480
Supplier: Prosci


Description: IL-13, Monoclonal Antibody, Clone: 1316H, Host: Rat, Species Reactivity: Mouse, Isotype: IgG1, kappa, Conjugate: SAFIRE Purified, Formulation: Phosphate-buffered aqueous solution, </=0.09% Sodium azide, may contain carrier protein, ph7.2, Application: FA, Size: 50ug
Catalog Number: 75842-612
Supplier: BIOGEMS INTERNATIONAL INC.


1,169 - 1,184 of 100,035