Print…

You Searched For: D-Asparagine+monohydrate


1,268  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1268"

Rate These Search Results

Product Image-10109-704

DDOST Antibody

Description: Polyclonal, Host Species: Rabbit, Species Reactivity: Human, Mouse, Rat, Canine, Zebrafish, Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human DDOST, Tested Application: Elisa, western blotting.
Catalog Number: 10109-704
Supplier: Prosci
Product Image-10108-878

SLC1A5 antibody

Description: Polyclonal, Host: Rabbit, Species reactivity: human mouse rat dog, Immunogen: produced in rabbits immunized with a synthetic peptide corresponding a region of human SLC1A5. purified by protein A chromatography method. Application: ELISA, western blot, IHC
Catalog Number: 10108-878
Supplier: Prosci
Image Unavailable-10454-966

DAD1 Antibody

Description: DAD1 Polyclonal Antibody, Host: Rabbit , Cy5.5 Conjugated, Emmission: 675nm/694nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: DAD 1; DAD-1; dad1; DAD1_HUMAN, Application: IF(IHC-P), 100ul
Catalog Number: 10454-966
Supplier: Bioss
Image Unavailable-76116-504

DAD1 Polyclonal Antibody 100ul

Description: DAD1 Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 750, Source: KLH conjugated synthetic peptide derived from human DAD1 Synonyms: DAD 1, DAD-1, dad1, DAD1_HUMAN, Application: IHC-P, IF(IHC-P), Size: 100ul
Catalog Number: 76116-504
Supplier: Bioss
Product Image-10085-298

Anti-CTBS

Description: Anti-CTBS Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-105 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10085-298
Supplier: Proteintech
Product Image-10095-356

Anti-STT3B

Description: Anti-STT3B Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-225 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower
Catalog Number: 10095-356
Supplier: Proteintech
Image Unavailable-10083-908

Anti-CA11

Description: Anti-CA11 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 12-328 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10083-908
Supplier: Proteintech
Product Image-10105-834

ASPH Antibody

Description: Polyclonal, Host Species: Rabbit, Species Reactivity: Human, Mouse, rat, Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human ASPH., Tested Application: Elisa, western blotting.
Catalog Number: 10105-834
Supplier: Prosci
Image Unavailable-CAPIPA5-18666

CGI58/ABHD5 Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Mouse (Ms) Immunogen:Synthetic peptide sequence (FPERPDLADQDR) corresponding to the internal amino acids of ABHD5
Catalog Number: CAPIPA5-18666
Supplier: Thermo Scientific
Image Unavailable-CA89176-418

ASPARAGINE MONOHYDRATE PURISS

Catalog Number: CA89176-418
Supplier: HiMedia
Image Unavailable-CA89176-416

ASPARAGINE MONOHYDRATE PURISS

Catalog Number: CA89176-416
Supplier: HiMedia
Image Unavailable-CAPIPA526445

SLC1A5 Polyclonal Antibody 100ug

Description: Host: Rabbit Species Reactivity: Human (Hu) Immunogen: Synthetic peptide from the Central region of human SLC1A5 conjugated to KLH.
Catalog Number: CAPIPA526445
Supplier: Thermo Scientific
Image Unavailable-103007-210

[Asn23]-beta-Amyloid (1-40) 0.5 mg

Description: [Asn23]-beta-Amyloid (1-40), Iowa Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV, Purity: HPLC >/= 95%, naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor, Molecular Weight: 4328.9, Size: 0.5 mg
Catalog Number: 103007-210
Supplier: Anaspec Inc
Product Image-10087-354

Anti-GALNS

Description: Anti-GALNS Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 174-522 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Catalog Number: 10087-354
Supplier: Proteintech
Image Unavailable-103007-212

[Gln22, Asn23] - beta - Amyloid (1 - 40) 0.5 mg

Description: [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-212
Supplier: Anaspec Inc
Product Image-10103-004

COX10 Antibody

Description: Polyclonal, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: Antibody produced in rabbits immunized with a synthetic peptide corresponding a region of human COX10, Applications: ELISA, WB, 50 ug
Catalog Number: 10103-004
Supplier: Prosci
977 - 992 of 1,268