You Searched For: 2-Amino-4-chloro-5-methylbenzenesulphonic+acid+sodium+salt


25  results were found

SearchResultCount:"25"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10668-660)
Supplier: Bioss
Description: The transcriptional enhancer factor-1 (TEF-1) family of transcription factors regulate tissue-specific gene expression in muscle and placenta. The mechanism whereby TEF-1 confers tissue specificity depends largely on the interaction of TEF-1 with tissue-specific cofactors. Transcription cofactor Vgl-3 (vestigial-like protein 3), also known as colon carcinoma related protein, is a 326 amino acid nuclear protein that may act as a specific coactivator for the mammalian transcription elongation factors. Both Vgl-1 and Vgl-3 are enriched in placenta, whereas Vgl-2 is expressed in differentiating somites and branchial arches during embryogenesis and is skeletal-muscle specific in adult tissues. There are two isoforms of Vgl-3 that are produced as a result of alternative splicing events.


Catalog Number: (10668-656)
Supplier: Bioss
Description: The transcriptional enhancer factor-1 (TEF-1) family of transcription factors regulate tissue-specific gene expression in muscle and placenta. The mechanism whereby TEF-1 confers tissue specificity depends largely on the interaction of TEF-1 with tissue-specific cofactors. Transcription cofactor Vgl-3 (vestigial-like protein 3), also known as colon carcinoma related protein, is a 326 amino acid nuclear protein that may act as a specific coactivator for the mammalian transcription elongation factors. Both Vgl-1 and Vgl-3 are enriched in placenta, whereas Vgl-2 is expressed in differentiating somites and branchial arches during embryogenesis and is skeletal-muscle specific in adult tissues. There are two isoforms of Vgl-3 that are produced as a result of alternative splicing events.


Catalog Number: (10421-818)
Supplier: Bioss
Description: FGFR1 Oncogene Partner is required for anchoring microtubules to the centrosomes. Ubiquitous; highly expressed in heart, liver, muscle, kidney, intestine, colon, adrenal gland, prostate, testis, and pancreas. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). There are three named isoforms.


Catalog Number: (CA10818-172)
Supplier: Biolegend
Description: BG-5 Monoclonal antibody, Clone: T174, Host: Mouse, Species reactivity: Human, Isotype: IgG1, Immunogen: developed against the SK-CO-10 colon cancer cell line, specific for the Lewis a type 1 chain, Formulation: Phosphate-buffered solution with BSA + 0.1% NaN3, Application: IHC, Size: 1ml


Catalog Number: (89359-532)
Supplier: Genetex
Description: The G protein-coupled receptor GPCR GPR81 has been reported primarily in adipose and pituitary. ESTs have been isolated from human bladder cancer and colon cancer libraries. It has not been detected in frontal, temporal and occipital lobes of the cortex, basal forebrain, caudate nucleus, nucleus accumbens, and hippocampus.


Catalog Number: (103006-558)
Supplier: Anaspec Inc
Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Peprotech
Description: PlGF-1 is an angiogenic factor that belongs to the cysteine-knot superfamily of growth factors. PlGF-1 is expressed in placental tissues, the colon, and mammary carcinomas. It signals through the VEGFR-1/FLT1 receptor, and stimulates endothelial cell proliferation and migration. Recombinant Human PlGF-1 is a 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains.

Catalog Number: (10108-280)
Supplier: Prosci
Description: Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.


Catalog Number: (76117-016)
Supplier: Bioss
Description: Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits <i>in vivo</i> proliferation of colon cancer cells.


Catalog Number: (89359-530)
Supplier: Genetex
Description: The G protein-coupled receptor GPR81 has been reported primarily in adipose and pituitary. ESTs have been isolated from human bladder cancer and colon cancer libraries. It has not been detected in frontal, temporal and occipital lobes of the cortex, basal forebrain, caudate nucleus, nucleus accumbens, and hippocampus.


Catalog Number: (10421-824)
Supplier: Bioss
Description: FGFR1 Oncogene Partner is required for anchoring microtubules to the centrosomes. Ubiquitous; highly expressed in heart, liver, muscle, kidney, intestine, colon, adrenal gland, prostate, testis, and pancreas. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). There are three named isoforms.


Catalog Number: (76078-452)
Supplier: Bioss
Description: FGFR1 Oncogene Partner is required for anchoring microtubules to the centrosomes. Ubiquitous; highly expressed in heart, liver, muscle, kidney, intestine, colon, adrenal gland, prostate, testis, and pancreas. A chromosomal aberration involving FGFR1OP may be a cause of stem cell myeloproliferative disorder (MPD). There are three named isoforms.


Catalog Number: (10467-490)
Supplier: Bioss
Description: Increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation.Tissue specificity:Expressed most abundantly in ovary and, at lower levels, in prostate, spleen and testis. Weak expression, if any, in thymus, small intestine, colon and peripheral blood leukocytes.


Catalog Number: (75962-250)
Supplier: Biotium
Description: This antibody recognizes a protein of HMW, identified as mucin 3 glycoprotein (MUC3). Its epitope localizes between aa SITTTE. This MAb shows no cross-reaction with human milk fat globule membranes, MUC1, or MUC2. MUC3 is distributed in colon and rectum, and is also present to a lesser extent in breast, lung and salivary gland tissues. The Mucins are a family of highly glycosylated, secreted proteins with a basic structure consisting of a variable number of tandem repeats (VNTRs) encoded by 60 base pairs (Mucin 1), 69 base pairs (Mucin 2) and 51 base pairs (Mucin 3). The number of repeats is highly polymorphic and varies among different alleles. Mucin 1 proteins are expressed as type I membrane proteins in addition to secreted forms. Mucin 1 is aberrantly expressed in epithelial tumors including breast carcinomas. Mucin 2 coats the epithelia of the intestines and airways and is associated with colonic tumors. Mucin 3 is a major component of various mucus gels and is broadly expressed in normal and tumor cells.


Catalog Number: (10108-526)
Supplier: Prosci
Description: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.


Catalog Number: (10093-752)
Supplier: Proteintech
Description: SDCCAG3, also named as NY-CO-3, is identified as serologically defined colon cancer antigen-3. It is an endosomal protein which is involved in the regulation of cytokinesis. SDCCAG3 is involved in modulation of TNF response. This gene has four isoforms with MW 40-50 kDa.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
no targeter for Bottom