Print…

You Searched For: Cbz-Ser(Bzl)-OH


8,839  results were found

Refine Results Sort by
SearchResultCount:"8839"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103003-094

PKG Substrate

Catalog Number: (103003-094)
Supplier: Anaspec Inc
Description: RKRSRAE is a selective substrate for protein kinase G (PKG) with a strong preference for PKG Iα (Km = 59 µM) over PKG II (Km = 305 µM).
Sequence:RKRSRAE
MW:902 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-N-1685.0001BA

WP9QY Trifluoroacetate

Catalog Number: (N-1685.0001BA)
Supplier: Bachem Americas
Description: The TNF-α antagonist WP9QY inhibited TNF-α mediated apoptosis and exhibited an IC₅₀ of 5 µM in the binding assay. YCWSQYLCY is the smallest peptidomimetic developed to date that might be used as a lead compound for the next generation of non-peptidic inhibitors. The name WP9QY arises from the binding to the site observed in the TNF-β/TNF-receptor(I) complex designated WP9 and the introduction of the amino acids Gln and Tyr.
Image Unavailable-103003-270

Prototype of RGD-containing Peptide, FITC (Fluorescein Isothiocyanate)

Catalog Number: (103003-270)
Supplier: Anaspec Inc
Description: This is a fluorescent (FITC)-labeled Prototype of RGD-containing peptide, Abs/Em=492/516 nm.
Sequence:FITC-LC-GRGDSP
MW:1091.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102997-404

Kemptide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc
Description: Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:5-FAM-LRRASLG
MW:1130.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-102996-352

[Des-Arg10]-HOE I40

Catalog Number: (102996-352)
Supplier: Anaspec Inc
Description: A potent B1 bradykinin receptor antagonist. HOE 140 helps to discriminate the roles of Bradykinin receptors.
Sequence:rRP-Hyp-G-Thi-S-(D-Tic)-Oic
MW:1148.2 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103006-920

HSV-gB2 (498-505)

Catalog Number: (103006-920)
Supplier: Anaspec Inc
Description: This is the immunodominant epitope gB-8p from herpes simplex virus (HSV) glycoprotein B (gB), amino acids 498 to 505.
Sequence:SSIEFARL
MW:922.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-280

Kemptide

Supplier: Anaspec Inc
Description: Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:LRRASLG
MW:771.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-H-7292.1000BA

Pg 99-465 Trifluoroacetate

Supplier: Bachem Americas
Description: PG 99-465 is a high affinity, selective VPAC2 receptor antagonist. It exhibited a 100-fold preference for the VPAC2 over the VPAC1 receptor. The compound showed partial agonistic activity on the VPAC1 receptor and was inactive on the VPAC2 receptor transfected in CHO cells, as well as on naturally expressed human VPAC2 receptors in the SUP T1 cell line. Dickson et al. observed an agonistic effect of PG99-465 on the human VPAC1 and PAC1 receptors. When applied singly, PG99-465 increased [cAMP](i) at all three hVPAC/PAC receptor subtypes.

Image Unavailable-102996-468

Human Thrombin Receptor Activator for Peptide 6

Supplier: Anaspec Inc
Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-102996-350

HOE I40

Catalog Number: (102996-350)
Supplier: Anaspec Inc
Description: Hoe 140 is a stable B2 bradykinin antagonist. Based on its high potency and good tolerability, Hoe 140 is used to evaluate the role of bradykinin in human diseases.
Sequence:rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
MW:1304.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-470

Human Thrombin Receptor Activator for Peptide 6

Catalog Number: (102996-470)
Supplier: Anaspec Inc
Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-H-6756.0005BA

Human (Des-Glu5)-Tetracosactide Trifluoroacetate

Supplier: Bachem Americas
Description: Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).

Image Unavailable-H-6754.0001BA

Human (Des-His6)-Tetracosactide Trifluoroacetate

Supplier: Bachem Americas
Description: Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).

Image Unavailable-103010-104

Rat GIP

Supplier: Anaspec Inc
Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-H-6758.0001BA

Human Endo-4A-Glu-Tetracosactide Trifluoroacetate

Supplier: Bachem Americas
Description: Please see also α-MSH (corresponds to acetyl-ACTH (1-13) amide, H-1075), α-MSH (free acid) (acetyl-ACTH (1-13), H-1070), and (Des-acetyl)-α-MSH (H-4390). Wied: Pituitary Adrenal System Hormones and Behaviour. Symposium on Developments in Endocrinology (1976) / Anon.: ACTH and Related Peptides: Structure, Regulation, and Action. Ann. N.Y. Acad. Sci. 297, 1 (1977) / A.V.Schally: Aspects of Hypothalamic Regulation of the Pituitary Gland. Science 202, 18 (1978) / R.Schwyzer: Studies on Polypeptide Receptors. A Critical View on the Mechanism of ACTH Action. Bull. Schweiz. Acad. Med. Wiss. 34, 263 (1978).

Image Unavailable-102996-874

MBP MAPK Substrate

Catalog Number: (102996-874)
Supplier: Anaspec Inc
Description: The sequence APRTPGGRR contains a native sequence derived from bovine myelin basic protein amino acids 95-98 (PRTP). The rest of the sequence is not derived from a native sequence, but is a synthetic construct. This substrate is specific for MAP kinases: p44MAPK [extracellular signal-regulated kinase 1 (ERK1)] and p42MAPK (ERK2). It contains the consensus sequence Pro-X-(Ser/Thr)-Pro that is recognized by MAP kinase. This peptide is the most efficient substrate for phosphorylation reaction by ERK. The substrate is phosphorylated by kinases on threonine 97 and can also be phosphorylated by MAPK p38.
Sequence:APRTPGGRR
MW:967.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
353 - 368 of 8,839
no targeter for Bottom