Print…

You Searched For: N-Benzyl-4-methoxyaniline


3,090  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"3090"

Rate These Search Results

Image Unavailable-76459-648

SP Wilmad-LabGlass Disposable NMR Tube Caps, SP Industries

Description: Manufactured from high quality polyethylene or ethylene vinyl acetate to ensure a tight seal.
Catalog Number: 76459-648
Supplier: SP Industries
Product Image-MFLX06363-55

CPC® Miniature Quick-Disconnect Fittings, Hose Barb Bodies

Description: No more kinked tubing—allows tubing to rotate freely.
Catalog Number: MFLX06363-55
Supplier: VWR International
Image Unavailable-CA75879-744

SiliaSep™ OT Open Top Flash Cartridges, SiliCycle

Description: SiliaSep OT cartridges are mainly used with vacuum manifolds and automated SPE equipment.
Catalog Number: CA75879-744
Supplier: SiliCycle
Product Image-RC11201

Bouin's Fixative

Description: Picric acid-formalin-acetic acid mixture.
Catalog Number: RC11201
Supplier: Ricca Chemical

SDS Certificates Small Business Enterprise


Image Unavailable-CAAA11846-09

Bismuth triacetate ≥99.999% (metals basis)

Description: MDL: MFCD00015629
Catalog Number: CAAA11846-09
Supplier: Thermo Scientific Chemicals

Certificates


Product Image-CAAGA5962012

Captiva Filter Plates, Agilent Technologies

Description: Captiva dual-depth filtration media removes precipitated proteins and prevents HPLC column clogging.
Catalog Number: CAAGA5962012
Supplier: AGILENT TECHNOLOGIES, INC (CSD) CA
Product Image-76394-714

Avantor® ACE® Generix®, Analytical UHPLC Columns, 1.8 µm

Description: These high performance UHPLC columns contain high purity spherical silica.
Catalog Number: 76394-714
Supplier: Avantor

Environmentally Preferable


Image Unavailable-G-2635.0250BA

H-Lys-Arg-OH acetate

Description: 1G CAS: 29586-66-1 C12H26N6O3 FW: 302.38
Catalog Number: G-2635.0250BA
Supplier: Bachem Americas
Image Unavailable-CAAA14600-18

Terbium triacetate hydrate ≥99.9% (REO, rare earth oxide basis), REacton®

Description: Terbium triacetate hydrate ≥99.9% (REO, rare earth oxide basis), REacton®
Catalog Number: CAAA14600-18
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA14576-09

Ytterbium triacetate hydrate ≥99.9% (REO, rare earth oxide basis), REacton®

Description: Ytterbium triacetate hydrate ≥99.9% (REO, rare earth oxide basis), REacton®
Catalog Number: CAAA14576-09
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-H-2435.0001BA

Human;Rat CRF Acetate

Description: CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.
Catalog Number: H-2435.0001BA
Supplier: Bachem Americas
Image Unavailable-H-6786.5000BA

Human Pth (2-34) Acetate

Description: H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Catalog Number: H-6786.5000BA
Supplier: Bachem Americas
Product Image-CA76474-522

Minisart® Syringe Filters NML

Description: Minisart NML standard syringe filter for clarification and sterilization of liquids and gases.
Catalog Number: CA76474-522
Supplier: Sartorius
Image Unavailable-CAAA14703-30

Silicon tetraacetate ≥97%

Description: Silicon tetraacetate ≥97%
Catalog Number: CAAA14703-30
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA40481-22

Erbium triacetate tetrahydrate ≥99.9% (REO, rare earth oxide basis), REacton®

Description: Erbium triacetate tetrahydrate ≥99.9% (REO, rare earth oxide basis), REacton®
Catalog Number: CAAA40481-22
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-TCB4214-25G

tert-Butyl (3R,5S)-6-hydroxy-3,5-O-isopropylidene-3,5-dihydroxyhexanoate ≥98.0% (by GC)

Description: CAS Number: 124655-09-0
MDL Number: MFCD23098985
Molecular Formula: C13H24O5
Molecular Weight: 260.33
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.06
Specific rotation [a]20/D: -4 deg (C=2, MeOH)
Storage Temperature: 0-10°C
Catalog Number: TCB4214-25G
Supplier: TCI America

SDS


449 - 464 of 3,090