You Searched For: Calcium+nitride


5,285  results were found

SearchResultCount:"5285"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76101-818)
Supplier: Bioss
Description: In plant cells, the vacuole functions as a major calcium store. Although a calmodulin-regulated Ca2+-ATPase (ACA4) is known to be present in prevacuolar compartments, the presence of an ACA-type Ca2+-ATPase in the mature vacuole of a plant cell has not been verified. Here we provide evidence that ACA11 localizes to the vacuole membrane. ACA11 tagged with GFP was expressed in stable transgenic plants, and visualized in root cells and protoplasts by confocal microscopy. A Ca2+-ATPase function for ACA11 was confirmed by complementation of yeast mutants.


Catalog Number: (CA97013-290)
Supplier: PerkinElmer
Description: Multi-Element Lumina™ hollow cathode lamp (HCL) for the detection of elemental Calcium (Ca) and Zinc (Zn). Series N30502XX Lumina™ 50 mm (2") diameter multi-element lamps are designed to be used with PinAAcle™ and AAnalyst™ Atomic Absorption spectrometer series of instruments.


Catalog Number: (76109-688)
Supplier: Bioss
Description: The EF-hand domain is a twelve amino acid loop motif that is commonly found in proteins that participate in calcium-binding events within the cell. EF-hand domains generally exist in a pair that, together, form a stable four-helix bundle that enables the binding of calcium ions. Swiprosin-2, also known as EFHD1 (EF-hand domain-containing protein D1), SWS2, PP3051 or MST133, is a 239 amino acid protein that contains two EF-hand domains and is expressed in a wide variety of tissues, including brain, liver, heart, kidney, testis, ovaries and spleen. Expression of Swiprosin-2, a possible calcium-binding protein, is upregulated during neuronal differentiation, suggesting a role for Swiprosin-2 in brain development and maturation.


Catalog Number: (76084-032)
Supplier: Bioss
Description: Calcium-binding protein. May have a role in calcium homeostasis. Nesfatin-1: Anorexigenic peptide, seems to play an important role in hypothalamic pathways regulating food intake and energy homeostasis, acting in a leptin-independent manner. May also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance (By similarity).


Catalog Number: (CAAAJ60887-MC)
Supplier: Thermo Scientific Chemicals
Description: Inhibits intracellular calcium release from the sarcoplasmic reticulum

Catalog Number: (89139-164)
Supplier: Biotium
Description: Difluoro BAPTA AM ester is a membrane permeable form of Difluoro BAPTA that can be loaded into cells by incubation. Difluoro BAPTA AM ester itself does not bind calcium, but once inside the cell is converted into Difluoro BAPTA by cytoplasmic esterases. See #50006 for information on Difluoro BAPTA.


Catalog Number: (CAPIPA5-18930)
Supplier: Thermo Scientific
Description: This antibody is predicted to react with bovine, canine, mouse, porcine and rat based on sequence homology. This gene is a member of the transient receptor family and the TrpV subfamily. The calcium-selective channel encoded by this gene has 6 transmembrane-spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats. This protein forms homotetramers or heterotetramers and is activated by a low internal calcium level.


Catalog Number: (10426-420)
Supplier: Bioss
Description: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity).


Catalog Number: (10426-422)
Supplier: Bioss
Description: Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity).


Catalog Number: (10450-798)
Supplier: Bioss
Description: There are four members (MRGX1-4) in the human MRGX familly. MRGX1 and MRGX2 receptors stimulate both G Alpha q- and G Alpha i -regulated pathways, while MRGX3 and MRGX4 receptors mainly activate G Alpha q-regulated pathways. G Alpha q proteins are involved in the calcium-signaling pathway downstream of the MRGX receptors. MRGX receptors are unique in that they are expressed in a subset of small dorsal root and trigeminal sensory neurons. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway.


Catalog Number: (10399-100)
Supplier: Bioss
Description: Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium.


Catalog Number: (10399-084)
Supplier: Bioss
Description: Initiates the extrinsic pathway of blood coagulation. Serine protease that circulates in the blood in a zymogen form. Factor VII is converted to factor VIIa by factor Xa, factor XIIa, factor IXa, or thrombin by minor proteolysis. In the presence of tissue factor and calcium ions, factor VIIa then converts factor X to factor Xa by limited proteolysis. Factor VIIa will also convert factor IX to factor IXa in the presence of tissue factor and calcium.


Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (10111-484)
Supplier: Prosci
Description: Calnuc or NUCB1 belongs to the nucleobindin family. It is a major calcium-binding protein of the Golgi and is a good Golgi marker. It may be involved in calcium homeostasis. Calnuc also plays roles in regulation of levels of.-amyloid precursor protein (APP) and its proteolytic metabolites to further affect the patho/physiological functions of APP including Alzheimer's disease pathogenesis. Useful for immunohistochemistry and western blot.


Catalog Number: (89165-942)
Supplier: Enzo Life Sciences
Description: Calcium dye


Catalog Number: (CA97013-286)
Supplier: PerkinElmer
Description: Multi-element Lumina™ Hollow Cathode Lamp (HCL) for the detection of elemental Calcium (Ca) and Magnesium (Mg). Series N30502XX Lumina™ 2" (50 mm) diameter multi-element lamps are designed to be used with PerkinElmer PinAAcle™ and AAnalyst™ Atomic Absorption (AA) spectrometer series of instruments.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,105 - 1,120 of 5,285
no targeter for Bottom