You Searched For: Calcium+molybdate


5,346  results were found

SearchResultCount:"5346"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (103008-282)
Supplier: Anaspec Inc
Description: This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (10390-186)
Supplier: Bioss
Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.


Catalog Number: (10390-188)
Supplier: Bioss
Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.


Catalog Number: (10665-634)
Supplier: Bioss
Description: Members of the EF-CBP (N-terminal EF-hand calcium binding protein)/NECAB (neuronal calcium-binding protein) family participate in neuronal calcium signaling. EF-CBP2, also known as NECAB2 (N-terminal EF-hand calcium binding protein 2), neuronal calcium-binding protein 2 or synaptotagmin-interacting protein 2 (Stip-2), is a 386 amino acid cytoplasmic protein that contains one antibiotic biosynthesis monooxygenase (ABM) domain and two EF-hand domains. Expressed in brain, EF-CBP2 is suggested to bind metabotropic glutamate receptor 5 (mGluR-5) in a calcium-regulated manner. The gene encoding EF-CBP2 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.


Catalog Number: (76121-066)
Supplier: Bioss
Description: Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1S gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, benzothiazepines, and by omega-agatoxin-IIIA (omega-Aga-IIIA). They are however insensitive to omega-conotoxin-GVIA (omega-CTx-GVIA) and omega-agatoxin-IVA (omega-Aga-IVA). Calcium channels containing the alpha-1S subunit play an important role in excitation-contraction coupling in skeletal muscle.


Supplier: WALLCUR, LLC.
Description: Prelabeled and packaged.

Catalog Number: (76701-228)
Supplier: AFG Bioscience
Description: Human S100 Calcium Binding Protein A8/A9 complex (S100A8/A9) ELISA Kit


Supplier: Bachem Americas
Description: ω-Conotoxin GVIA from the venom of the fish-hunting cone snail Conus geographus efficiently blocks neuronal calcium channels. This presynaptic inhibition of calcium influx prevents the voltage-activated release of acetylcholine.

Supplier: WALLCUR, LLC.
Description: Preloaded Syringes For Your EMS, ACLS Or Nursing Training

Catalog Number: (10486-410)
Supplier: Bioss
Description: Senses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.


Catalog Number: (10101-768)
Supplier: Prosci
Description: L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.


Supplier: Puritan Medical Products
Description: General all purpose swabs for wound care

Product available on GSA Advantage®

Catalog Number: (76714-584)
Supplier: AFG Bioscience
Description: Rat Calcium Binding Protein B (S100B) ELISA Kit


Catalog Number: (77439-016)
Supplier: Bioss
Description: The sarcoplasmic reticulum (SR) is, in part, responsible for maintaining the level of intracellular calcium in cardiac and skeletal muscle by storing and releasing calcium. Several intralumenal SR calcium binding proteins have been identified, the most prominent of these is calsequestrin. Calsequstrin is a calcium binding protein known to sequester calcium accumulated in the sarcoplasmic reticulum of muscle cells during relaxation and is found discretely localized to the junctional and corbular (terminal cisternae) SR. Calsequestrin functions to localize calcium near the junctional face of the terminal cisternae from which calcium can be released into the cytosol via the ryanodine receptor. This protein is highly acidic and has a large capacity and moderate to low affinity for calcium.


Catalog Number: (89139-296)
Supplier: Biotium
Description: Kit provides a range of calibration buffers with accurate calcium concentrations and is useful for the calibration of fluorescent Ca² indicators (1,2).


Catalog Number: (ABCA_AB2783-100UG)
Supplier: Abcam
Description: Mouse monoclonal [JA9] to Calcium Pump PMCA4 ATPase.

New Product


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
465 - 480 of 5,346
no targeter for Bottom