You Searched For: Calcium+glycerophosphate


5,246  results were found

SearchResultCount:"5246"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76705-828)
Supplier: AFG Bioscience
Description: Rat S100 Calcium Binding Protein B(S100-B) ELISA Kit


Catalog Number: (ABCA_AB214190-100U)
Supplier: Abcam
Description: Rabbit polyclonal to S100 Calcium Binding Protein A13/S100A13.

New Product


Catalog Number: (10083-938)
Supplier: Proteintech
Description: CACNA1S, also named as CACH1, CACN1 and CACNL1A3, belongs to the calcium channel alpha-1 subunit (TC 1.A.1.11) family and CACNA1S subfamily. Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. CACNA1S gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. The antibody is specific to CACNA1S.


Catalog Number: (77438-766)
Supplier: Bioss
Description: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.


Catalog Number: (75792-024)
Supplier: Prosci
Description: Protein S100-P (S100P) belongs to the S100 family of Calcium-Binding Proteins. S100P is 95 amino acids in length and it contains 2 EF-Hand Calcium-Binding Motifs. The EF-Hand Motif binds calcium, which likely alters molecular conformation. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells and it is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. In addition to binding Ca, S100P also binds Zn and Mg, and may play a role in the etiology of prostate cancer.


Catalog Number: (89139-160)
Supplier: Biotium
Description: BAPTA and its derivatives are calcium chelators that are commonly used to form calcium buffers with well-defined calcium concentrations. By injecting the chelators into cells or by incubating cells with the AM ester form of the chelators, one can control the cytosolic calcium concentration, an important means to study the roles of calcium.


Catalog Number: (10665-630)
Supplier: Bioss
Description: Members of the EF-CBP (N-terminal EF-hand calcium binding protein)/NECAB (neuronal calcium-binding protein) family participate in neuronal calcium signaling. EF-CBP2, also known as NECAB2 (N-terminal EF-hand calcium binding protein 2), neuronal calcium-binding protein 2 or synaptotagmin-interacting protein 2 (Stip-2), is a 386 amino acid cytoplasmic protein that contains one antibiotic biosynthesis monooxygenase (ABM) domain and two EF-hand domains. Expressed in brain, EF-CBP2 is suggested to bind metabotropic glutamate receptor 5 (mGluR-5) in a calcium-regulated manner. The gene encoding EF-CBP2 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.


Catalog Number: (103008-282)
Supplier: Anaspec Inc
Description: This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (76712-226)
Supplier: AFG Bioscience
Description: Human Calcium-Activated Chloride channel regulator 4(CLCA4) ELISA Kit


Catalog Number: (77989-257)
Supplier: LGC Standards
Description: TRC 3-Methyl-2-oxovaleric acid calcium salt

New Product


Catalog Number: (10665-638)
Supplier: Bioss
Description: Members of the EF-CBP (N-terminal EF-hand calcium binding protein)/NECAB (neuronal calcium-binding protein) family participate in neuronal calcium signaling. EF-CBP2, also known as NECAB2 (N-terminal EF-hand calcium binding protein 2), neuronal calcium-binding protein 2 or synaptotagmin-interacting protein 2 (Stip-2), is a 386 amino acid cytoplasmic protein that contains one antibiotic biosynthesis monooxygenase (ABM) domain and two EF-hand domains. Expressed in brain, EF-CBP2 is suggested to bind metabotropic glutamate receptor 5 (mGluR-5) in a calcium-regulated manner. The gene encoding EF-CBP2 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.


Catalog Number: (10665-640)
Supplier: Bioss
Description: Members of the EF-CBP (N-terminal EF-hand calcium binding protein)/NECAB (neuronal calcium-binding protein) family participate in neuronal calcium signaling. EF-CBP2, also known as NECAB2 (N-terminal EF-hand calcium binding protein 2), neuronal calcium-binding protein 2 or synaptotagmin-interacting protein 2 (Stip-2), is a 386 amino acid cytoplasmic protein that contains one antibiotic biosynthesis monooxygenase (ABM) domain and two EF-hand domains. Expressed in brain, EF-CBP2 is suggested to bind metabotropic glutamate receptor 5 (mGluR-5) in a calcium-regulated manner. The gene encoding EF-CBP2 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.


Catalog Number: (89139-296)
Supplier: Biotium
Description: Kit provides a range of calibration buffers with accurate calcium concentrations and is useful for the calibration of fluorescent Ca² indicators (1,2).


Catalog Number: (10099-794)
Supplier: Prosci
Description: SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).


Catalog Number: (10168-088)
Supplier: Genetex
Description: Mouse monoclonal antibody [C2C12] to Sodium/Calcium Exchanger


Catalog Number: (ABCA_AB2783-100UG)
Supplier: Abcam
Description: Mouse monoclonal [JA9] to Calcium Pump PMCA4 ATPase.

New Product


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
417 - 432 of 5,246
no targeter for Bottom