You Searched For: Calcium+chloride


9,606  results were found

SearchResultCount:"9606"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CAPIPA5-15302)
Supplier: Thermo Scientific
Description: TRPCs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants.[supplied by OMIM]


Catalog Number: (89165-944)
Supplier: Enzo Life Sciences
Description: Calcium dye


Catalog Number: (89319-850)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to CaMKI gamma (calcium/calmodulin-dependent protein kinase IG)


Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (CAMK7550-32)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Magnesium chloride hexahydrate FCC, Macron Fine Chemicals™


Catalog Number: (10167-264)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to S100B (S100 calcium binding protein B)


Catalog Number: (77178-052)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [S100A13/7484] antibody to S100 Calcium Binding Protein A13/S100A13 for IHC-P with samples derived from Human.


Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Pyrogen tested.
Supplier: QUALITY BIOLOGICAL, INC.
Description: DPBS is a balanced salt solution (BSS) used for the handling and culturing of mammalian cells. Calcium and magnesium facilitate cell binding and clumping. DPBS without these ions can be used to wash and rinse suspended cells.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Catalog Number: (89355-586)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to CaMK1D (calcium/calmodulin-dependent protein kinase ID)


Catalog Number: (10464-238)
Supplier: Bioss
Description: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.


Catalog Number: (77178-050)
Supplier: ANTIBODIES.COM LLC
Description: Mouse monoclonal [S100A13/7483] antibody to S100 Calcium Binding Protein A13/S100A13 for IHC-P with samples derived from Human.


Catalog Number: (10071-822)
Supplier: Prosci
Description: RPS6KB1 phosphorylates the Ribosomal Protein-S6. Activation of RPS6KB1 requires a complex, ordered series of conformational changes and phosphorylation reactions. While the role of sequential, multi-site phosphorylation has been extensively detailed, characterization of the priming step required to initiate this cascade has remained elusive. Probably this priming process is dependent on calcium. Calcium-dependent regulation of RPS6KB1 does not specifically target Thr-229 and Thr-389, the key regulatory phosphorylation sites; rather, calcium chelation results in a global inhibition of RPS6KB1 phosphorylation. The initial calcium-dependent process is required to release an inhibitory interaction between the C- and N-termini of RPS6KB1, thus allowing phosphorylation of key domains. The priming event involves formation of a calcium-dependent protein complex that releases the interaction between the N- and C-termini. RPS6KB1 is then accessible for activation by the kinases that target the known regulatory phosphorylation sites.


Catalog Number: (10666-158)
Supplier: Bioss
Description: The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008].


Catalog Number: (76109-790)
Supplier: Bioss
Description: The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.


Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Magnesium chloride hexahydrate ≥99%, crystals, BAKER ANALYZED® ACS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
865 - 880 of 9,606
no targeter for Bottom