Print…

You Searched For: Calcium


6,760  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"6760"

Rate These Search Results

Image Unavailable-89357-796

Rabbit Polyclonal antibody to Calcium binding protein P22

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: ICC/IF, IHC-P, WB Pkg Size: 100 ul
Catalog Number: 89357-796
Supplier: Genetex
Image Unavailable-102996-094

Parathyroid Hormone (1-34) 1 mg

Description: Parathyroid Hormone (1-34), human, Purity: HPLC >/= to 95%, Molecular Weight: 4117.8, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVF, Appearance: Lyophilized white powder, regulates the metabolism of calcium and phosphate, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-094
Supplier: Anaspec Inc
Image Unavailable-CAPIPA5-18617

CACNB4 Polyclonal Antibody 100ug

Description: Host:Goat Species Reactivity:Human (Hu) Immunogen:Synthetic peptide sequence (DYPDSYQDTYKPH) corresponding to the internal amino acids of CACNB4
Catalog Number: CAPIPA5-18617
Supplier: Thermo Scientific
Image Unavailable-89319-850

Rabbit Polyclonal antibody to CaMKI gamma (calcium/calmodulin-dependent protein kinase IG)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89319-850
Supplier: Genetex
Image Unavailable-77438-938

ANTIBODY MCU POLYCLONAL 100UL

Catalog Number: 77438-938
Supplier: Bioss
Image Unavailable-10396-952

BNIP3 Antibody

Description: BNIP3 Polyclonal Antibody, Host: Rabbit , Cy3 Conjugated, Emmission: 512,550nm/570,615nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: BCL2 Adenovirus E1B 19kDa Interacting Protein 3, Application: IF(IHC-P), 100ul
Catalog Number: 10396-952
Supplier: Bioss
Image Unavailable-10464-236

SERCA1 ATPase Antibody

Description: SERCA1 ATPase Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: AT2A1_HUMAN; ATP2A; ATP2A1, Application: IF(IHC-P), 100ul
Catalog Number: 10464-236
Supplier: Bioss
Image Unavailable-89320-564

Rabbit Polyclonal antibody to CAB39 (calcium binding protein 39)

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: ICC/IF, IHC-P, WB Pkg Size: 100 ul
Catalog Number: 89320-564
Supplier: Genetex
Image Unavailable-10405-416

BNIP3 Antibody

Description: BNIP3 Polyclonal Antibody, Host: Rabbit , HRP Conjugated, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: BCL2 Adenovirus E1B 19kDa Interacting Protein 3, Application: IHC-P, 100ul
Catalog Number: 10405-416
Supplier: Bioss
Image Unavailable-76078-386

BNIP3 PAB 100ul

Description: BNIP3 Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 680, Immunogen: KLH conjugated synthetic peptide derived from BNIP3, Synonyms: BCL2 Adenovirus E1B 1, Interacting Protein 3, adenovi
Catalog Number: 76078-386
Supplier: Bioss
Image Unavailable-76078-388

BNIP3 PAB 100ul

Description: BNIP3 Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 750, Immunogen: KLH conjugated synthetic peptide derived from BNIP3, Synonyms: BCL2 Adenovirus E1B 1, Interacting Protein 3, adenovi
Catalog Number: 76078-388
Supplier: Bioss
Product Image-89348-712

Rabbit Polyclonal antibody to CIB1 (calcium and integrin binding 1 (calmyrin))

Description: Purity: Purified by antigen-affinity chromatography. Species Reactivity: Human Tested Applications: WB Pkg Size: 100 ul
Catalog Number: 89348-712
Supplier: Genetex
Image Unavailable-77178-052

ANTIBODY A315569-100

Catalog Number: 77178-052
Supplier: ANTIBODIES.COM LLC
Image Unavailable-77439-920

ANTIBODY CATSPER POLYCLONAL 100UL

Catalog Number: 77439-920
Supplier: Bioss
Image Unavailable-CADX2510-3

Desiccant, DRIERITE®

Description: Desiccant, DRIERITE®
Catalog Number: CADX2510-3
Supplier: MilliporeSigma

SDS Certificates


Product Image-10095-716

Anti-TRPV6

Description: Anti-TRPV6 Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Recombinant Protein, 1-106 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IF, Recommended Storage: - 20 C or lower
Catalog Number: 10095-716
Supplier: Proteintech
1,121 - 1,136 of 6,760