You Searched For: Calcium


5,231  results were found

SearchResultCount:"5231"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (ABCA_AB3530-100UG)
Supplier: Abcam
Description: Rabbit polyclonal to Calcium Pump PMCA3 ATPase.

New Product


Catalog Number: (89139-160)
Supplier: Biotium
Description: BAPTA and its derivatives are calcium chelators that are commonly used to form calcium buffers with well-defined calcium concentrations. By injecting the chelators into cells or by incubating cells with the AM ester form of the chelators, one can control the cytosolic calcium concentration, an important means to study the roles of calcium.


Catalog Number: (10665-630)
Supplier: Bioss
Description: Members of the EF-CBP (N-terminal EF-hand calcium binding protein)/NECAB (neuronal calcium-binding protein) family participate in neuronal calcium signaling. EF-CBP2, also known as NECAB2 (N-terminal EF-hand calcium binding protein 2), neuronal calcium-binding protein 2 or synaptotagmin-interacting protein 2 (Stip-2), is a 386 amino acid cytoplasmic protein that contains one antibiotic biosynthesis monooxygenase (ABM) domain and two EF-hand domains. Expressed in brain, EF-CBP2 is suggested to bind metabotropic glutamate receptor 5 (mGluR-5) in a calcium-regulated manner. The gene encoding EF-CBP2 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.


Catalog Number: (ABCA_AB96713-50UL)
Supplier: Abcam
Description: Rabbit polyclonal to Calcium channel L type DHPR gamma 5 subunit.

New Product


Catalog Number: (77989-257)
Supplier: LGC Standards
Description: TRC 3-Methyl-2-oxovaleric acid calcium salt

New Product


Supplier: Puritan Medical Products
Description: General all purpose swabs for wound care

Product available on GSA Advantage®

Catalog Number: (ABCA_AB214190-100U)
Supplier: Abcam
Description: Rabbit polyclonal to S100 Calcium Binding Protein A13/S100A13.

New Product


Catalog Number: (89139-296)
Supplier: Biotium
Description: Kit provides a range of calibration buffers with accurate calcium concentrations and is useful for the calibration of fluorescent Ca² indicators (1,2).


Catalog Number: (10099-794)
Supplier: Prosci
Description: SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).


Supplier: Abcam
Description: Rabbit monoclonal [EPR25106-37] to Sodium/calcium exchanger 2.

New Product

Catalog Number: (ABCA_AB2783-100UG)
Supplier: Abcam
Description: Mouse monoclonal [JA9] to Calcium Pump PMCA4 ATPase.

New Product


Catalog Number: (10390-190)
Supplier: Bioss
Description: Cav2.1 is a voltage-sensitive calcium channels (VSCC) which belongs to the calcium channel alpha-1 subunit family. Cav2.1 mediates the entry of calcium ions into excitable cells and is also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Cav2.1 (isoform alpha-1A) gives rise to P and/or Q-type calcium currents. Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.


Catalog Number: (ABCA_AB238110-100U)
Supplier: Abcam
Description: Rabbit polyclonal to Calcium channel L type DHPR alpha 2 subunit/CACNA2D1.

New Product


Catalog Number: (77440-534)
Supplier: Bioss
Description: Calcium-dependent phospholipid-binding protein that plays a role in Calcium-mediated intracellular processes. Exhibits Calcium-dependent cell membrane binding properties.


Catalog Number: (77461-762)
Supplier: AAT BIOQUEST INC
Description: Cal-520® amine is an excellent building block that can be readily used to prepare a calcium-sensitive bioconjugate for monitoring calcium change spatially for a specific target.


Catalog Number: (103008-282)
Supplier: Anaspec Inc
Description: This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
417 - 432 of 5,231
no targeter for Bottom